KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17510Help
Entry
NRG857_17510      CDS       T02068                                 

Definition
(RefSeq) putative outer membrane biogenesis protein
  KO
K07290  AsmA family protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    NRG857_17510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA AsmA_2 DUF748
Motif
Other DBs
NCBI-GeneID: 12876464
NCBI-ProteinID: YP_006121844
UniProt: A0A0H3EN44
Position
complement(3696556..3698616)
Genome map
AA seq 686 aa AA seqDB search
MSKAGKITAAISGAFLLLIVVAIILIATFDWNRLKPTINQKVSAELNRPFAIRGDLGVVW
ERQKQETGWRSWVPWPHVHAEDIILGNPPDIPEVTMVHLPRVEATLAPLALLTKTVWLPW
IKLEKPDARLIRLSEKNNNWTFNLANDDNKDANAKPSAWSFQLDNILFDQGRIAIDDKVS
KADLEIFVDPLGKPLPFSEVTGSKGKADKEKVGDYVFGLKAQGRYNGEPLTGTGKIGGML
ALRGEGTPFPVQADFRSGNTRVAFDGVVNDPMKMGGVDLRLKFSGDSLGDLYELTGVLLP
DTPPFETDGRLVAKIDTEKSSVFDYRGFNGRIGDSDIHGSLIYTTGKPRPKLEGDVESRQ
LRLADLGPLIGVDSGKGAEKSKRSEQKKGEKSVQPAGKVLPYDRFETDKWDVMDADVRFK
GRRIEHGSSLPISDLSTHIILKNADLRLQPLKFGIAGGSIAANIHLEGDKKPMQGRADIQ
ARRLKLKELMPDVELMQKTLGEMNGDAELRGSGNSVAALLGNSNGNLKLLMNDGLVSRNL
MEIVGLNVGNYIVGAIFGDDEVRVNCAAANLDIANGVARPQIFAFDTENALINITGTASF
ASEQLDLTIDPESKGIRIITLRSPLYVRGTFKNPQAGVKAGPLIARGAVAAALATLVTPA
AALLALISPSEGEANQCRTILSQMKK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcaggcaaaataaccgctgcgatttcaggggctttcttgttgttgattgtc
gtggcgatcattttgattgcaacttttgactggaatcgactcaaaccgaccatcaaccag
aaagtctctgcggagttgaatcgtccgttcgctatccgtggcgatctgggcgtggtgtgg
gagcggcaaaaacaagaaactggctggcgcagctgggtgccgtggccccatgtacacgcg
gaagacatcattcttggcaatccaccggatattcccgaagtcacaatggtgcatttgccg
cgagtagaagcgacgctggccccgctggcgctgctgaccaaaacggtctggttgccgtgg
atcaagctcgaaaagcccgacgcgcgcctgattcgcctctccgaaaagaacaataactgg
acgtttaatctcgccaacgatgacaacaaagacgcgaatgcaaagccgtcggcgtggtcg
tttcagctggataatattcttttcgatcaagggcggatcgccattgatgacaaagtaagc
aaagcggatctggaaatttttgtcgatccgttaggcaagccgctgccgttcagcgaagtt
accggatcgaaaggtaaagcggataaagaaaaggtgggcgattacgtttttggcctgaag
gcgcagggacgttataacggtgaaccgctcactggtacgggaaaaataggcggtatgctg
gcgctgcgtggcgaaggaacgccgtttccggtacaggctgatttccgctctggtaacacc
cgtgttgcttttgatggcgttgtgaatgacccaatgaagatggggggtgtcgatttacgg
cttaaattttctggcgattcgctgggtgatctctatgaactgacgggcgttctgctgccc
gatacaccgccgtttgaaacggatggtcggctggtagcgaaaatcgacactgaaaaatcg
tcggtctttgattatcgcggttttaatgggcgcattggcgatagcgatatccacggttct
ctgatctacaccaccggcaagccacgaccaaaactggaaggtgatgtcgagtcgcggcaa
ttgcggctggcggacctgggaccgttgattggcgttgattccgggaaaggggcagaaaag
tcgaaacggtctgaacagaagaagggcgaaaaaagcgttcagcctgcgggcaaagtgctg
ccttatgaccgcttcgaaaccgataaatgggacgttatggatgccgatgttcgcttcaaa
gggcggcgcattgagcatggcagcagcctgccgattagcgatctttctactcatatcatc
ctcaaaaatgctgacctgcgtctgcaaccgctgaaatttggcatagcgggcggcagcatt
gcggcgaatattcatctggaaggcgataaaaagccgatgcaggggcgggcagatattcag
gctcgtcgactgaaactgaaagaactgatgcccgatgtagaactgatgcagaagacgctg
ggggaaatgaacggtgacgcggaactgcgcggtagcggtaactcggtggcggcgctttta
ggcaacagtaacggcaacctgaaactgttgatgaatgacgggctggtgagccgcaacctg
atggagattgttgggctgaatgtcggcaactacattgtcggtgcgatatttggtgatgat
gaggtgcgggtgaactgcgcggcggcgaatctggatattgccaacggcgtggcgcgcccg
cagatttttgctttcgatactgagaacgcgttgattaacattaccggcacggcaagtttt
gcttcggaacagctggatttgactattgatccggagagtaaagggattcggatcatcaca
ctgcgttcgccgctgtatgtgcgtgggacgtttaaaaatccgcaggctggggtgaaagcc
gggccgttgattgctcgcggagccgttgcggcggcactggcaacgctggtaacaccggcg
gcggcgttactggcgctgatctcaccttccgaaggggaggctaatcagtgcaggacaatt
ttgtcgcagatgaaaaagtga

DBGET integrated database retrieval system