KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17515Help
Entry
NRG857_17515      CDS       T02068                                 

Definition
(RefSeq) EAL domain-containing protein
  KO
K21086  c-di-GMP phosphodiesterase [EC:3.1.4.52]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eln00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    NRG857_17515
Enzymes [BR:eln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.52  cyclic-guanylate-specific phosphodiesterase
     NRG857_17515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL
Motif
Other DBs
NCBI-GeneID: 12876465
NCBI-ProteinID: YP_006121845
UniProt: A0A0H3EN77
Position
complement(3698686..3699453)
Genome map
AA seq 255 aa AA seqDB search
MIRQVIQRISNPEASIESLQERRFWLQCERAYTWQPIYQTCGRLMAVELLTVVTHPLNPS
QRLPPDRYFTEITVSHRMEVVKEQIDLLAQKADFFVEHGLLASVNIDGPTLIALRQQPKI
LRQIEDLPWLRFELVEHIRLPKDSTFASMCEFGPLWLDDFGTGMANFSALSEVRYDYIKI
ARELFVMLRQSPEGRTLFSQLLHLMNRYCRGVIVEGVETPEEWRDVQNSPAFAAQGWFLS
RPAPIETLNTAVLAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgataaggcaggttatccagcgaataagcaaccctgaagcaagcatcgagagcttgcag
gaacggcgtttttggttgcagtgtgagcgtgcttacacttggcagccgatctatcaaaca
tgcgggcggttaatggccgtggagctattaacggtggtcacgcatcccttgaacccttcg
caacgcctgccgccggatcgctattttactgaaatcaccgttagccatcggatggaggtt
gtgaaagagcagattgatttgctggcgcaaaaagccgacttctttgtagagcacggcctg
ctggcatcggtcaatattgatggccctacgctcatcgccctgcgtcagcaaccaaaaatc
ctgcgccagattgaggatcttccctggctgcgtttcgaactggtggaacacatccgcctg
ccgaaagattcaacctttgcctcgatgtgtgaatttggcccgctgtggctggatgatttt
ggtaccgggatggcaaatttctctgcactaagtgaagtgcgttatgactacatcaaaatc
gcgcgagaactgtttgtgatgctgcgtcagtcgccggaaggacgcacactcttttctcag
cttttacatctaatgaatcgctattgtcgcggggtgattgtcgagggcgtagaaacaccg
gaagagtggcgtgatgttcagaactcgcccgcattcgccgcacaaggctggtttctttca
cgcccggcaccgatagaaacgctgaatacggcggttctggcgctataa

DBGET integrated database retrieval system