KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17525Help
Entry
NRG857_17525      CDS       T02068                                 

Definition
(RefSeq) zinc-dependent peptidase
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_C Peptidase_M16 DUF2993
Motif
Other DBs
NCBI-GeneID: 12876467
NCBI-ProteinID: YP_006121847
UniProt: A0A0H3EMV3
Position
complement(3700710..3702206)
Genome map
AA seq 498 aa AA seqDB search
MQGTKIRLLAGGLLMMATAGYVQADALQPDPAWQQGTLSNGLQWQVLTTPQRPSDRVEIR
LLVNTGSLAESTQQSGYSHAIPRIALTQSGGLDAAQARSLWQQGIDPKRPMPPVIVSYDT
TLFNLSLPNNRNDLLKEALSYLANATGKLTITPETINHALQSQDMVATWPADTKEGWWRY
RLKGSTLLGHDPADPLKQPVEAEKIKDFYQKWYTPDAMTLLVVGNVDARSVVDQINKTFG
ELKGKRETPAPVPTLSPLRAEAVSIMTDAVRQDRLSIMWDTPWQPIRESAALLRYWRADL
AREALFWHVQQALSASNSKDIGLGFDCRVLYLRAQCAINIESPNDKLNSNLNLVARELAK
VRDKGLPEEEFNALVAQKKLELQKLFAAYARADTDILMGQRMRSLQNQVVDIAPEQYQKL
RQDFLNSLTVEMLNQDLRQQLSNDMALILLQPKGEPEFNMKALQAAWDQIMAPSTAAAAT
SVATDDVHPEVTDIPPVQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcacaaaaattcgacttttagcgggcggtttgctgatgatggccactgctggc
tatgtgcaggcagatgcgctccagcctgatccagcatggcaacaggggacgctttccaac
ggtttacagtggcaagtgctgactacgccccaacgtcccagcgatcgtgttgaaattcgc
ctgctggttaataccggttcgctcgccgaaagtacacaacagagcggttacagtcacgcc
atccctcgtattgcgctaacgcaaagcggtggccttgacgcagcgcaggcgcgttcattg
tggcagcaggggatcgaccctaaacgcccgatgccgccggtaattgtctcttatgacacc
acgctgtttaatctgagtttgcccaataaccgtaacgacttgctgaaagaggcgctctct
tatctggcaaatgccactggcaaactgactatcacgccagaaaccatcaaccatgcgttg
caaagtcaggacatggtggcaacctggcctgccgatactaaagagggctggtggcgttat
cgtctgaaaggatcaaccttgttaggtcacgatcctgccgatccgctgaaacaacccgtt
gaagcggaaaagattaaagatttctatcagaaatggtacaccccggatgcaatgacgctg
ctggtggtgggaaacgtggatgcgcgctcggtcgtcgaccaaatcaataaaacgtttggc
gaactgaaaggcaaacgtgaaacaccggctccggtgccgacgctttctccgctgcgtgcg
gaagcggtgagtattatgaccgacgcggtgcgtcaggaccggctatctatcatgtgggat
acgccgtggcagccgattcgtgaatcagccgcactgctgcgctactggcgtgcggacctg
gcccgtgaggcgctgttctggcatgttcagcaagcgttaagcgccagtaacagtaaagac
atcggtcttggatttgactgtcgtgtgctgtatctgcgtgcgcagtgtgccatcaacatc
gaatcaccaaacgacaagctgaacagcaaccttaatctggtggcgcgtgaactggcgaag
gttcgcgataaaggtctgccggaagaagagttcaatgcgttagtggcgcaaaagaaactg
gagctgcagaaactgtttgccgcctatgcgcgagctgataccgatattctgatggggcag
cggatgcgttcgttgcaaaatcaggtcgtcgatatcgcgccggagcaatatcagaaactg
cgtcaggatttccttaacagcctgacggtggagatgttaaatcaggatctgcgtcagcag
ttgtcgaatgatatggcgttaatactgctgcagccgaaaggcgagccggaatttaacatg
aaagcgttgcaggcggcctgggatcaaatcatggccccatcgactgcggctgccgccaca
tctgtcgccacggatgacgtacatcctgaagtgacggatattccacctgtacagtaa

DBGET integrated database retrieval system