KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17540Help
Entry
NRG857_17540      CDS       T02068                                 

Definition
(RefSeq) cellulose synthase subunit BcsC
  KO
K20543  cellulose synthase operon protein C
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17540
Transporters [BR:eln02000]
 Other Transporters
  Pores ion channels [TC:1]
   NRG857_17540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BCSC_C TPR_19 TPR_16 TPR_2 TPR_14 TPR_8 TPR_1 TPR_7 TPR_12 TPR_20 TPR_11 BTAD TPR_6 TPR_9 TPR_15 TPR_17 TPR_10
Motif
Other DBs
NCBI-GeneID: 12876470
NCBI-ProteinID: YP_006121850
UniProt: A0A0H3EN80
Position
complement(3705965..3709438)
Genome map
AA seq 1157 aa AA seqDB search
MRKFTLNIFTLSLGLAVMPMVEAAPTAQQQLLEQVRLGEATHREDLVQQSLYRLELIDPN
NPDVIAARFRSLLRQGDIDGAQKQLDRLSQLAPSSNAYKSSRTTMLLSTPDGRQALQQAR
LQATTGHAEEAVASYNKLFNGAPPEGDIAVEYWSTVAKIPARRGEAINQLKRINADTPGN
TGLQNNLALLLFSSDRRDEGFAVLEQMAKSNAGREGASKIWYGQIKDMPVSDASVQALKK
YLSIFSDGDSVAAAQSQLAEQQKQLADPAFRARAQGLAAVDSGMAGKAIPELQQAVRANP
KDSEALGALGQAYSQKGDRANAVVNLEKALALDPHNSNNDKWNSLLKVNRYWLAIQQGDA
ALKANNPDRAERLFQQARNVDNTDSYAVLGLGDVAMARKDYPAAERYYQQTLRMDSGNTN
AVRGLANIYRQQSPEKAEAYIASLSASQRRSIDDIERSLQNDRLAQQAEALENQGKWAQA
AALQRQRLALDPGSVWITYRLSQDLWQAGQRSQADTLMRNLAQQKPNDPEQVYAYGLYLS
GHDQDRAALAHINSLPRGQWNSNIQELVNRLQNDQVLETANRLRENGKEAEAEAMLRQQP
PSSRIDLTLADWAQQRRDYTAARAAYQNVLTREPTNADAILGLTEVDIAAGDKAAARSQL
AKLPAIDNASLNTQRRVALAQAQLGDTAAAQQTFNKLIPQAKSQPPSMESAMVLRDGAKF
EALAGDPTQALETYKDAMVASGVTTTRPQDNDTFTRLTRNDEKDDWLKRGVRSDTADLYR
QQDLNVTLEHDYWGSSGTGGYSDLKAHTTMLQVDAPYSDGRMFFRSDFVNMNVGSFSTNA
DGKWDDNWGTCTLQDCSGNRSQSDSGASVAVGWRNDVWSWDIGTTPMGFNVVDVVGGISY
SDDIGPLGYTVNAHRRPISSSLLAFGGQKDSPSNTGKKWGGVRADGVGLSLSYDKGEANG
VWASLSGDQLTGKNVEDNWRVRWMTGYYYKVINQNNRRVTIGLNNMIWHYDKDLSGYSLG
QGGYYSPQEYLSFAIPVMWRERTENWSWELGASGSWSHSRTKTMPRYPLMNLIPTDWQEE
AARQSNDGGSSQGFGYTARALLERRVTSNWFVGTAIDIQQAKDYAPSHFLLYVRYSAAGW
QGDMDLPPQPLIPYADW
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaattcacactaaacatattcacgctttccctcggtctggccgtcatgccgatg
gtcgaggcagcaccaaccgctcagcaacagttgctggagcaagttcggttaggcgaagcg
acccatcgtgaagacctggtgcaacagtcgttgtatcggctggaacttattgatccgaat
aacccggatgtgattgctgcccgttttcgttctctgttacgtcagggcgatattgatggc
gcacaaaaacagctcgatcggctgtcgcagttagcgccgagttcaaatgcgtataaatcg
tcgcggaccacaatgttactgtctacgccggatggtcgtcaggcactgcaacaggctcga
ttgcaggcgactaccggtcatgcggaagaggccgtggcgagttacaacaagctgttcaac
ggtgcgccgccggaaggtgacattgctgtcgagtactggagtacggtggcgaaaattccg
gctcgccgtggtgaagcgattaatcagctaaaacgcattaatgcggatacgccgggcaat
acgggcctgcaaaacaatctggcgctattactgtttagtagcgatcgccgtgacgaaggt
tttgccgtcctggaacagatggcgaaatcgaacgccgggcgcgaaggggcctctaaaatc
tggtacgggcagattaaagacatgcccgtcagcgatgccagcgtgcaggcactgaaaaaa
tatctctcgatctttagcgatggcgatagcgtggctgctgcacaatcgcaactggcagaa
cagcaaaaacagctggccgaccctgctttccgcgctcgtgcgcaaggtttagcggcggtg
gactctggcatggcgggtaaagccattcccgaactacaacaggcggtgcgggcgaacccg
aaagacagtgaggctctgggggcgctgggccaggcgtattcccagaaaggcgatcgcgcc
aatgcagtggtgaatctggaaaaagccctcgcgctggatccgcacaacagcaataacgac
aaatggaacagcctgctgaaagtaaaccgctactggctggcgatccagcagggcgatgcc
gcgctgaaagccaataatcctgaccgggcagaacggctgttccagcaggcacgtaatgtc
gataacaccgacagctatgcagtgcttgggctgggcgatgtggcgatggcgcgcaaagat
tatcccgccgccgaacgctattaccagcagaccttgcgtatggacagcggcaacactaac
gccgtgcgcgggctggcgaatatttaccgccagcagtcgccagaaaaagccgaagcgtat
atcgcctcgctctctgccagccagcggcgcagcattgatgatatcgaacgcagcctgcaa
aacgaccgtctggcacagcaggcagaggcactggaaaaccaggggaaatgggcgcaggcg
gcagcacttcagcggcaacgactggcgctggaccccggcagtgtatggattacttaccga
ctttcgcaggatctctggcaagccggacaacgcagccaggccgatacgttaatgcgcaat
ctggcgcagcagaagccgaacgacccggagcaggtttacgcttacgggctgtacctctcc
ggtcacgaccaggacagagcggcgctggcgcatatcaacagcctgccgcgcgggcagtgg
aacagcaatattcaggagctggttaatcgactgcaaaacgatcaggtgctggaaaccgct
aatcgcctgcgagaaaacggtaaagaggcagaagcggaagcgatgctgcgccagcaaccg
ccttcctcgcgtattgacctcacgctggctgactgggcgcagcagcgacgtgattacacc
gccgcccgcgctgcatatcagaatgtcctgacgcgggagccaactaacgccgatgccatt
cttggtctgacggaagtggatattgctgccggtgacaaagcggcggcacgtagccagctg
gcgaaactgcctgccattgataacgcctcgctgaacacacagcggcgcgtggcgctggca
caggcgcagcttggcgataccgcagcggcgcagcagacatttaataagttgatcccgcag
gcaaaatctcagccaccgtcgatggaaagcgcgatggtactgcgtgatggtgcgaagttt
gaagcgctggcgggcgatccaacgcaggcgctggaaacctacaaagacgctatggttgca
tccggtgtgaccacgacgcgtccgcaggataacgacacctttacccggctgacccgtaac
gacgagaaagatgactggctgaaacgcggcgtgcgcagcgatacggcggacctctatcgc
cagcaggatcttaacgtcactctcgagcacgattactggggttcgagcggtaccggtggt
tactccgatctgaaagcgcacaccactatgttgcaggtggacgcgccctattctgacggg
cggatgttctttcgcagtgatttcgtcaatatgaacgtcggcagtttctccactaatgcc
gatggcaaatgggatgacaactggggcacctgtacattacaggactgtagcggcaaccgc
agccagtcggattccggtgccagcgtggcggtcggctggcgaaatgacgtctggagctgg
gatatcggtaccacgccgatgggcttcaacgtggtggatgtggtcggcggcatcagttac
agcgatgatatcgggccgctgggttacaccgttaacgcccaccgtcggcctatctccagt
tctttgctggcctttggtgggcaaaaagactctccgagcaataccgggaaaaaatggggc
ggcgtgcgtgccgacggcgtggggctaagtctgagctacgataaaggtgaagcaaacggc
gtctgggcatcgcttagcggtgatcagttaaccggtaaaaatgtcgaagataactggcgc
gtgcgctggatgacgggctattactataaggtcatcaaccagaacaatcgccgcgtcaca
atcggcctgaacaacatgatctggcattatgacaaagacctgagtggctactcactcggt
cagggcggttactacagtccgcaggaatacctgtcgtttgccataccggtgatgtggcgg
gagcgcacggaaaactggtcgtgggagctgggggcgtctggctcgtggtcgcattcacgc
accaaaaccatgccgcgttatccgctgatgaatctgatcccgaccgactggcaggaagaa
gctgcgcggcaatccaacgatggcggcagcagtcagggctttggctacacggcgcgggca
ttacttgaacgacgtgttacttccaactggtttgtcggcacggcaattgatatccagcag
gcaaaagattacgcccccagccatttcctgctctacgtacgttattccgccgccggatgg
cagggtgacatggatttaccgccgcagccgctgataccttacgccgactggtaa

DBGET integrated database retrieval system