KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17560Help
Entry
NRG857_17560      CDS       T02068                                 

Definition
(RefSeq) cell division protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBP_BcsQ AAA_31 CbiA ArsA_ATPase ParA
Motif
Other DBs
NCBI-GeneID: 12876474
NCBI-ProteinID: YP_006121854
UniProt: A0A0H3EN53
Position
complement(3715498..3716250)
Genome map
AA seq 250 aa AA seqDB search
MAVLGLQGVRGGVGTTTITAALAWSLQMLGENVLVVDACPDNLLRLSFNVDFTHRQGWAR
AMLDGQDWRDAGLRYTSQLDLLPFGQLSIEEQENPQHWQTRLSDICTGLQQLKASGRYQW
ILIDLPRDASQITHQLLSLCDHSLAIVNVDANCHIRLHQQALPDGAHILINDFRIGSQVQ
DDIYQLWLQSQHRLLPMLIHRDEAMAECLAAKQPVGEYRSDALAAEEILTLANWCLLNYS
GLKTPVGSAS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccgtactgggattgcagggggttcggggaggcgtggggacaacaaccatcaccgcc
gcattagcctggtcattacaaatgttgggagaaaatgtcctggtggtcgatgcctgcccg
gacaacttgttgcgcctgtcatttaacgttgattttacccaccgtcagggttgggccaga
gctatgctggatggccaggactggcgtgacgccgggttgcgctatacctcgcagctcgat
ttgctgccttttggtcagttatccattgaagaacaagaaaatccacagcactggcaaacc
cggctgagcgatatttgcaccggcttacagcaactaaaagccagcgggcgttaccagtgg
attttaattgacttaccgcgtgatgcctcgcagataacccaccagctgctgagtttgtgc
gatcactcgctggcaatcgtcaatgtggatgccaactgccacatccgactgcatcagcaa
gcgctgccggatggtgcacatattttgattaatgacttccgtattggcagccaggttcag
gacgatatttaccagctttggttgcaaagccagcaccgattgctgccgatgctcattcat
cgtgatgaagcgatggctgaatgtctggcagctaagcaaccagtcggtgaatatcgcagt
gatgcgctggcggctgaagagatactgacgctggcgaactggtgcctgttgaattattcc
gggctgaaaacgccagtcgggagtgcatcatga

DBGET integrated database retrieval system