KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17580Help
Entry
NRG857_17580      CDS       T02068                                 

Definition
(RefSeq) putative endoglucanase involved in cellulose biosynthesis
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBP_BcsG
Motif
Other DBs
NCBI-GeneID: 12876478
NCBI-ProteinID: YP_006121858
UniProt: A0A0H3EQY1
Position
3718479..3720158
Genome map
AA seq 559 aa AA seqDB search
MTQFTQNTAMPSSLWQYWRGLSGWNFYFLVKFGLLWAGYLNFHPLLNLVFAAFLLMPIPR
YSLHRLRHWIALPIGFALFWHDTWLPGPESIMSQGSQVAGFSTDYLIDLVTRFINWQMIG
AIFVLFVAWLFLSQWIRITVFVVAILLWLNVLTLAGPSFSLWPAGQPTTTVTTTGGNAAA
TVAATGGAPVVGDIPAQTAPPTTANLNAWLNNFYNAEAKRKSIFPSSLPADAQPFELLVI
NICSLSWSDIEAAGLMSHPLWSHFDIEFKNFNSATSYSGPAAIRLLRASCGQTSHTNLYQ
PANNDCYLFDNLSKLGFTQHLMMGHNGQFGGFLKEVRENGGMQSELMDQTNLPVILLGFD
GSPVYDDTAVLNRWLDVTEKDKNSRSATFYNTLPLHDGNHYPGVSKTADYKARAQKFFDE
LDAFFTELEKSGRKVMVVVVPEHGGALKGDRMQVSGLRDIPSPSITDVPVGVKFFGMKAP
HQGAPIVIDQPSSFLAISDLVVRVLDGKIFSEDNVDWKKLTSGLPQTAPVSENSNAVVIQ
YQDKPYVRLNGGDWVPYPQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatttacgcaaaataccgccatgccttcttccctctggcaatactggcgcggc
ctttccggctggaacttctattttctggttaagttcggtctgttgtgggcgggatatctt
aacttccatccgctcctcaatctggtgtttgccgcgtttctgctaatgcccattccgcgc
tacagcctgcatcgcttgcgccactggattgccctgccgatcggctttgctttgttctgg
catgacacctggttgcctggcccggaaagcataatgagccagggttcgcaggtggcgggg
ttcagtaccgattatttaatcgatcttgtcacacgctttattaactggcagatgattggg
gccatttttgttttattcgtggcctggttattcctgtcacaatggattcgcattaccgtt
tttgtggttgccattctgctatggctgaacgtacttaccctggcgggaccaagtttctcc
ttgtggccagccggtcaaccgacgaccactgtaacaacgacgggtggtaacgcagcggca
accgttgcggcgacgggtggcgcaccggtagtgggtgatatacccgcacaaactgcaccg
ccaacaacagcaaaccttaacgcctggctgaataatttctataacgcggaggcgaaacgt
aaatcgatcttcccgtcttcgctgcccgctgatgctcagccatttgaactactggtgatt
aatatctgttcgctttcctggtcggatattgaagccgccggattgatgtcgcatccactg
tggtcgcatttcgatattgagttcaagaactttaactccgccacctcctacagtggcccg
gcggcgatccgtttactgcgcgccagctgcgggcagacttcgcacactaatctgtatcaa
ccggcaaataacgactgctatctgtttgataacctgtcgaaactgggctttacccagcac
ctgatgatgggacataacggccagttcggcggttttttgaaagaagttcgcgaaaatggc
ggcatgcagagcgaattgatggatcaaacaaatctgccggttattttgctgggctttgat
ggttcgccggtttatgacgataccgccgtgcttaaccgttggctggacgttaccgaaaaa
gataaaaacagccgtagtgccacgttctacaacacgcttccactgcatgacggcaaccat
tatccgggcgtcagcaaaacagcggattacaaagcgcgggcgcaaaaattctttgatgaa
ctggacgccttctttactgaactggagaaatcgggtcgtaaagtgatggtggtcgtggtg
ccggaacacggcggcgcgctgaagggcgacagaatgcaggtatctggtctacgtgatatc
cctagcccgtctatcacagacgtccccgttggggtgaaattcttcggcatgaaggcacca
catcagggggcaccgattgtcatcgaccaaccgagcagcttcctggctatctccgatctg
gtggttcgcgttcttgatggcaagattttctccgaagacaatgttgactggaaaaaactc
accagtgggttgccacaaacagcaccggtctccgagaactcaaatgcagtagttattcaa
taccaggataaaccgtacgttcgcctgaacggcggcgactgggtgccttacccgcaataa

DBGET integrated database retrieval system