KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17595Help
Entry
NRG857_17595      CDS       T02068                                 

Gene name
dppF
Definition
(RefSeq) dipeptide transporter ATP-binding subunit
  KO
K12372  dipeptide transport system ATP-binding protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln02010  ABC transporters
Module
eln_M00324  Dipeptide transport system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NRG857_17595 (dppF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17595 (dppF)
Transporters [BR:eln02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00324] [OT]
    NRG857_17595 (dppF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_16 AAA_21 AAA_22 RsgA_GTPase IstB_IS21 AAA_29 AAA_23 Tub_N ATPase
Motif
Other DBs
NCBI-GeneID: 12876481
NCBI-ProteinID: YP_006121861
UniProt: A0A0H3EQA8
Position
complement(3722129..3723133)
Genome map
AA seq 334 aa AA seqDB search
MSTHEATPQQPLLQAIDLKKHYPVKKGMFAPERLVKALDGVSFNLERGKTLAVVGESGCG
KSTLGRLLTMIETPTGGELYYQGQDLLKHDPQAQKLRRQKIQIVFQNPYGSLNPRKKVGQ
ILEEPLLINTSLSKEQRQEKALSMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLDP
DVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFISHDLSVVEHIADEVMVMYLGRC
VEKGTKDQIFNNPRHPYTQALLSATPRLNPDDRRERIKLTGELPSPLNPPPGCAFNARCR
RRFGPCIQLQPQLKDYGGQLVACFAVDQDENPQR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcatgaggccaccccgcaacaaccgctgttgcaggctatcgacctgaaaaaa
cattatccggtgaagaaaggcatgttcgcgccggaacgtctggtgaaggcgctggatggc
gtttcgtttaaccttgaacgtggcaaaacgctggcagtagtaggtgaatctggctgcggt
aaatcgaccctaggtcggttgctgacgatgattgaaacgcccaccggcggcgaactgtat
taccaggggcaggatctgctcaagcacgatccgcaggcgcagaagctacgtcggcagaaa
atccagattgtcttccagaacccttacggttcgctgaatccgcgtaaaaaagttgggcag
attctcgaagagccgctgctgatcaacaccagcttaagcaaagaacagcgtcaggaaaaa
gccctgtcgatgatggcgaaagtcggcctgaaaaccgagcattacgaccgctatccgcat
atgttctccggcggtcagcgtcagcgtatcgccattgcccgaggtctgatgctcgacccg
gatgtggtgattgccgatgagccggtttccgcgctggacgtctcagtgcgtgcgcaggtg
ctgaatctgatgatggatttgcagcaggaactggggctatcttatgtctttatctcgcac
gatctgtcggtggtggagcacattgctgatgaagtgatggtgatgtacctgggccgctgc
gtggagaaggggacgaaggaccaaatcttcaataacccgcgccacccgtacactcaggcg
ctgctctccgcgacaccacgcctgaacccggacgatcgtcgcgaacgcatcaaacttacc
ggtgaactgccaagcccgctgaatccaccgccaggctgcgccttcaacgcccgctgtcgt
cggcgcttcggcccctgcatccagttgcagccgcagctaaaagactacggcggtcaactg
gtagcctgttttgccgttgatcaggatgaaaatccgcagcgttaa

DBGET integrated database retrieval system