KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17665Help
Entry
NRG857_17665      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autotransporter
Motif
Other DBs
NCBI-GeneID: 12876575
NCBI-ProteinID: YP_006121875
UniProt: A0A0H3ENA1
Position
complement(3738022..3738720)
Genome map
AA seq 232 aa AA seqDB search
MIIKKSGGRWQLSLLASVVISAFFLNTAYAWQQEYIVDTQPGHSTERYTWDSDHQPDYND
ILSQRIQSSQRALGLEVNLAEETPVDVTSSMSMGWNFPLYEQVTTGPVAAFHYDGTTTSM
YNEFGDSTTTLADPLWHASVSTLGWRVDSRLGDLRPWAQISYNQQFGENIWKAQSGLSRM
TATNQNGNWLDVTVGADMLLNQNIAAYAALSQAENTTNNSDYLYTMGVSARF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcataaaaaaaagcggtggtcgctggcagctaagcctgcttgcgagcgtggtaatc
agtgccttttttctcaacacagcttacgcctggcaacaagaatatatcgttgatacgcaa
cccggacattccacagagcgttacacctgggatagcgatcatcaacctgattacaacgat
attttgtcgcaacgtattcaaagtagccaaagggcgctgggactggaagtcaatctggcg
gaagaaacccctgtggatgtgaccagcagtatgagtatgggctggaattttcctttatat
gagcaggttacaaccggcccggtcgcggcatttcattacgatggcacaaccacctcgatg
tataacgagtttggcgacagtactaccacgctggccgatccgttatggcatgccagcgtg
agtaccttaggctggcgtgttgactcccggcttggcgatctccgaccctgggcgcaaatc
agctataaccagcaatttggcgagaatatctggaaggcgcaatcaggcctgagccggatg
acggcgacaaaccagaacggcaactggctggatgtcaccgtaggcgctgatatgttgctc
aatcaaaatattgctgcctatgctgcgctatctcaggcagaaaataccactaacaatagc
gactatctgtatacgatgggggttagcgccagattttaa

DBGET integrated database retrieval system