KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17670Help
Entry
NRG857_17670      CDS       T02068                                 

Definition
(RefSeq) 3-methyladenine DNA glycosylase
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:eln00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    NRG857_17670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eln03400]
    NRG857_17670
Enzymes [BR:eln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     NRG857_17670
DNA repair and recombination proteins [BR:eln03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     NRG857_17670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco RBD
Motif
Other DBs
NCBI-GeneID: 12876576
NCBI-ProteinID: YP_006121876
UniProt: A0A0H3EQC2
Structure
PDB: 

Position
3738878..3739441
Genome map
AA seq 187 aa AA seqDB search
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACF
HQFDPVKVAAMQEEDIERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFV
NHQPQVTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCC
CHPGNKP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttgcggctgggtgagtcaggacccgctttatattgcctaccatgataatgaa
tggggcgtgcctgaaactgacagtaaaaaactgttcgaaatgatctgccttgaagggcag
caggctgggttatcgtggatcaccgtcctcaaaaaacgcgaaaactatcgcgcatgcttt
catcagttcgatccggtgaaagttgccgcaatgcaggaagaggatatcgaaagactggta
caggacgccgggattatccgccatcgtgggaaaattcaggcaattattggtaatgcgcgg
gcgtacctgcaaatggaacagaacggcgaaccgtttgccgactttgtctggtcgtttgtc
aatcatcaaccacaggtgacacaagccacaacgttgagcgaaatccccacatctacaccc
gcctccgacgccctatctaaggcactaaaaaaacgtggttttaagtttgtcggtaccaca
atctgttactcctttatgcaggcatgtgggctggtgaatgatcatgtggttggctgctgt
tgccatccgggaaataaaccatga

DBGET integrated database retrieval system