KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17675Help
Entry
NRG857_17675      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
  KO
K03826  putative acetyltransferase [EC:2.3.1.-]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NRG857_17675
Enzymes [BR:eln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     NRG857_17675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_4 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 12876577
NCBI-ProteinID: YP_006121877
UniProt: A0A0H3EMX9
Position
3739438..3739878
Genome map
AA seq 146 aa AA seqDB search
MIREVQRSELPAILQLWLESTTWGHPFIKSSYWRDCIPLVRDAYLANAQNWVWEEDGKLL
GFVSIMEGRFLAAMFVAPKAVRRGIGKALMQYVQQRHPHLMLEVYQKNQPAIDFYHAQGF
HIVDCAWQDETQLPTWIMSWPVVQTL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgattcgggaagtgcaacgttcagaactccccgcgatcctccaactgtggctggaaagt
acaacctgggggcatccctttataaaatcgagttactggcgtgactgcattccgctggtg
cgggatgcgtatcttgccaacgcgcaaaactgggtctgggaagaagacggtaagcttctc
ggttttgtcagcattatggaaggccgattcctcgcagcaatgtttgtcgcaccgaaggcc
gtcagacgcggtattggtaaggcgctaatgcagtatgtgcagcagcgccatccccatctg
atgctggaggtttatcaaaaaaatcaaccggcgatagatttctaccatgcgcagggtttt
cacattgtcgattgcgcatggcaggatgaaacccaactacccacctggattatgagctgg
ccggtggttcaaacgctgtaa

DBGET integrated database retrieval system