KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17680Help
Entry
NRG857_17680      CDS       T02068                                 

Definition
(RefSeq) biotin sulfoxide reductase
  KO
K08351  biotin/methionine sulfoxide reductase [EC:1.-.-.-]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00780  Biotin metabolism
eln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NRG857_17680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17680
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     NRG857_17680
Transporters [BR:eln02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   NRG857_17680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding
Motif
Other DBs
NCBI-GeneID: 12876578
NCBI-ProteinID: YP_006121878
UniProt: A0A0H3ER16
Position
complement(3739847..3742126)
Genome map
AA seq 759 aa AA seqDB search
MLVETDGETVFSSRGALATGMENSLQSAVRDQVHSNTRVRFPMVRKGFLASPENPQGIRG
QDEFVRVSWDEALELIHHQHKRIREAYGPASIFAGSYGWRSNGVLHKASTLLQRYMALAG
GYTGHLGDYSTGAAQAIMPYVVGGSEVYQQQTSWPLVLEHSDVVVLWSANPLNTLKIAWN
ASDEQGLSYFSALRDSGKKLICIDPMRSETIDFFGDKMEWVAPHMGTDVALMLGIAHTLV
ENGWHDEAFLARCTTGYAVFASYLLGESDGIAKNAEWAAEICGVGAAKIRELAAIFHQNT
TMLMAGWGMQRQQFGEQKHWMLVTLAAMLGQIGTPGGGFGLSYHFANGGNPTRRAAVLSS
MQGSLPGGTDAVDKIPVARIVEALENPGGAYQHNGMDRHFPDIRFIWWAGGANFTHHQDT
NRLIRAWQKPELVVISECFWTAAAKHADIVLPATTSFERNDLTMTGDYSNQHLVPMKQVV
PPRDEARNDFDVFADLSERWEKGGYTRFTEGKSELQWLETFYNVARQRGASQQVELPPFA
EFWQANQLIEMPENPDSERFIRFADFRRDPQAHPLKTASGKIEIFSQRIADYAYPDCPGH
PMWLAPDEWQGSAEPEQLQVLSAHPAHRLHSQLNYSSLRELYAVANREPVTIHPEDAQTR
GIQDGDTVRLWNSRGQILAGAVISEGIKPGVICIHEGAWPDLDLIAGGICKNGAVNVLTK
DLPSSRLGNGCAGNTALAWLEKYTGPELTLTAFEPPASS
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgctggttgaaaccgacggcgaaaccgtgtttagctcgcgtggcgcgttagccacagga
atggaaaactccttgcagagcgcggttcgcgaccaggttcacagcaatacgcgggtgcga
tttccaatggtgcgcaaaggctttcttgcgtcaccggaaaatccgcaaggcattcgtggg
caggatgaatttgttcgcgtgagttgggatgaggcgctggagcttattcaccatcaacat
aaacgcattcgtgaggcttatggtccggcatcgatttttgctggttcctacggctggcgt
tcaaacggcgtgctgcataaggcctcgacattattacaacgctatatggcgctggcaggc
ggttatactgggcatctgggggattattcgaccggcgcggcacaggcgatcatgccgtat
gtcgtgggtggcagcgaagtttatcaacagcaaaccagttggccgctggtgctggaacat
agcgatgtcgtggtgctgtggagtgctaacccactcaatacgctgaaaattgcgtggaat
gcatccgatgagcaggggctttcttacttttccgcactgcgtgacagcgggaaaaagctg
atctgcattgatccaatgcgatcggaaaccatcgatttctttggcgataaaatggagtgg
gtggcaccacacatgggcaccgatgttgcgttgatgctggggatcgcccatacgctggtg
gaaaatggttggcacgacgaagcgtttctggcgcgttgcaccacaggttatgccgtcttc
gcctcttatttgctgggcgagagtgacggtatagcgaaaaacgccgaatgggcggcagag
atttgtggtgttggcgcagcgaaaatccgcgagctggcggctattttccaccaaaataca
accatgctgatggcaggctggggaatgcagcgccaacagtttggtgagcaaaaacactgg
atgctcgtcacgctggcggcaatgttggggcaaatcggcacacccggcggcggttttggt
ctttcttaccattttgccaatggtggtaaccccacgcgccgcgctgcggtgctctcttcc
atgcagggcagcttgccgggtggcaccgatgcggtagataaaatccctgtcgcccgcatt
gttgaagcactggaaaaccctggtggcgcatatcaacataacggtatggaccgacatttc
ccggatattcgttttatctggtgggcgggtggtgccaactttactcatcatcaggatacc
aatcgcctgatccgtgcctggcaaaaaccggagctggtggtgatctccgaatgcttctgg
acggctgcggcgaaacacgcggatatcgttctgcctgcgacaacctcttttgagcgtaat
gatctcaccatgaccggtgattacagtaatcagcatctggtgccgatgaagcaagtggtg
ccgccacgcgatgaagcgcgtaatgattttgatgtttttgccgacttgagtgaacgttgg
gagaagggcggttatacacgttttacggaaggaaaaagtgagctgcaatggctggaaacg
ttttataacgttgcccggcagcgcggggcaagccagcaggttgaattgccaccatttgct
gagttctggcaagccaaccagttaattgagatgccggaaaacccggacagtgagcggttt
attcgcttcgccgattttcgccgcgatccgcaggcgcatccattaaaaaccgccagcggt
aagattgaaatcttctcgcagcgtattgccgattacgcttatccggattgcccggggcat
ccaatgtggctggcgccggacgaatggcagggcagtgccgaaccggaacagttgcaggta
ctttctgctcatccggcgcatcgtctgcacagccagctgaattacagttctctgcgcgaa
ttgtacgcggtggcaaatcgtgagcctgtcaccattcatcctgaagatgcccagacgcgc
ggcatacaagatggcgatactgttcggctgtggaactcacgcgggcaaattcttgccggc
gcggtcattagcgagggaattaaacctggcgtgatttgtattcacgaaggcgcatggccg
gatttggatttaatcgctggcggcatttgtaaaaacggcgcagtgaacgtgctgaccaaa
gatctccccagctcgcggctggggaatggctgtgcgggtaatacggcgctggcatggctg
gaaaaatacaccggtccggaactgacacttacagcgtttgaaccaccggccagctcataa

DBGET integrated database retrieval system