KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17685Help
Entry
NRG857_17685      CDS       T02068                                 

Definition
(RefSeq) putative outer membrane lipoprotein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA Gly-zipper_Omp Gly-zipper_YMGG Rick_17kDa_Anti
Motif
Other DBs
NCBI-GeneID: 12876579
NCBI-ProteinID: YP_006121879
UniProt: A0A0H3EN73
Structure
PDB: 

Position
3742333..3742992
Genome map
AA seq 219 aa AA seqDB search
MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG
KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS
ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGSHDLNMRLSQQRADSVASALITQG
VDASRIRTQGLGPANPIASNSTSEGKAQNRRVEITLSPL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacgtgtttatcttattgccgccgtagtgagtggcgctctggcggtatctggc
tgtacaactaacccttacaccggcgaacgcgaagcaggtaaatctgctatcggcgcaggt
ctgggctctctcgttggcgcgggtattggtgcgctctcttcttcgaagaaagatcgcggt
aaaggcgcgctcattggcgcagcagcaggcgcagctctgggcggcggcgttggttattac
atggatgtgcaggaagcgaagctgcgtgacaaaatgcgcggcactggtgttagcgtaacc
cgcagcggggataacattatcctcaatatgccgaacaatgtgaccttcgacagcagcagc
gcaaccctgaaaccggcgggcgctaacaccctgaccggcgtggcaatggtactgaaagag
tatccgaaaacggcggttaacgtgattggttataccgacagcacggggagtcacgacctg
aacatgcgtctctcccagcagcgtgcggattccgttgccagcgcgttgatcacccagggc
gtggacgccagccgcatccgtactcaaggccttggcccggctaacccaatcgccagcaac
agcacctcagaaggtaaggcgcaaaaccgccgtgtagaaattaccttaagcccactgtaa

DBGET integrated database retrieval system