KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17690Help
Entry
NRG857_17690      CDS       T02068                                 

Definition
(RefSeq) 2-ketoaldonate reductase/glyoxylate reductase B
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00030  Pentose phosphate pathway
eln00260  Glycine, serine and threonine metabolism
eln00620  Pyruvate metabolism
eln00630  Glyoxylate and dicarboxylate metabolism
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NRG857_17690
   00620 Pyruvate metabolism
    NRG857_17690
   00630 Glyoxylate and dicarboxylate metabolism
    NRG857_17690
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NRG857_17690
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     NRG857_17690
    1.1.1.81  hydroxypyruvate reductase
     NRG857_17690
    1.1.1.215  gluconate 2-dehydrogenase
     NRG857_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 12876580
NCBI-ProteinID: YP_006121880
UniProt: A0A0H3ENA6
Position
3743096..3744070
Genome map
AA seq 324 aa AA seqDB search
MKPSVILYKALPDDLLQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAAL
LEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVE
VAERVKAGEWTASIGPDWYGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHH
KEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAEQFAKMKSSAIFINAGRGPV
VDENALIAALQKGEIHAAGLDVFEQEPLSVDSPLLSMANVVAVPHIGSATHETRYGMAAC
AVDNLIDALQGKVEKNCVNPHVAD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccgttatcctctacaaagccttacctgatgatttactgcaacgcctgcaa
gaacatttcaccgttcaccaggtggcaaacctcagcccacaaaccgtcgaacaaaatgca
gcaatttttgccgaagctgaaggcttgctgggttcaaacgagaatgttgatgccgcattg
ctggaaaaaatgccgaaactgcgtgccacatcaacgatctccgtcggctatgacaatttt
gatgtcgatgcgcttaccgcccgaaaaattctgctgatgcacacaccaaccgtattaaca
gaaaccgtcgccgatacgctgatggcgctggtgttgtctaccgctcgtcgggttgtagag
gtagcagaacgggtaaaagcaggcgaatggaccgcgagcataggcccggactggtacggc
actgacgttcaccataaaacactgggcattgtcgggatgggacggatcggcatggcgctg
gcacaacgtgcgcactttggcttcaacatgcccatcctctataacgcgcgtcgccaccat
aaagaagcagaagaacgcttcaacgcccgctactgcgatttggatactctgttacaagag
tcagatttcgtttgcctgatcctgccgttaacggatgagacgcatcatctgtttggcgca
gaacaattcgccaaaatgaaatcctccgccattttcattaatgccggacgtggcccggtg
gttgatgaaaatgcactgattgctgcattgcagaaaggggaaattcacgccgccgggctg
gatgtcttcgaacaagagccactgtccgtagattcgccgttgctctcaatggccaacgtc
gtcgcagtaccgcatattggatctgccactcatgagacgcgttatggcatggccgcctgt
gccgtggataatttgattgatgcgttacaaggaaaggttgagaagaactgtgtgaatccg
cacgtcgcggactaa

DBGET integrated database retrieval system