KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17710Help
Entry
NRG857_17710      CDS       T02068                                 

Definition
(RefSeq) small toxic polypeptide
  KO
K18920  protein HokA
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eln02048]
    NRG857_17710
Prokaryotic defense system [BR:eln02048]
 Toxin-antitoxin system (TA system)
  Type I TA system
   Hok-Sok
    NRG857_17710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HOK_GEF DUF3149
Motif
Other DBs
NCBI-GeneID: 12876584
NCBI-ProteinID: YP_006121884
UniProt: A0A0H3EN96
Position
complement(3746235..3746387)
Genome map
AA seq 50 aa AA seqDB search
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaaatatagattactttctttaatagtgatttgtttcacgcttttatttttc
acctggatgataagagattcactgtgtgaattgcatattaaacaggagagttatgagctg
gcggcgtttttagcctgcaaattgaaagagtaa

DBGET integrated database retrieval system