KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17715Help
Entry
NRG857_17715      CDS       T02068                                 

Gene name
glyS
Definition
(RefSeq) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00970  Aminoacyl-tRNA biosynthesis
Module
eln_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:eln00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    NRG857_17715 (glyS)
Enzymes [BR:eln01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     NRG857_17715 (glyS)
Amino acid related enzymes [BR:eln01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   NRG857_17715 (glyS)
Transfer RNA biogenesis [BR:eln03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NRG857_17715 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-GeneID: 12876585
NCBI-ProteinID: YP_006121885
UniProt: A0A0H3ENB3
Position
complement(3746710..3748779)
Genome map
AA seq 689 aa AA seqDB search
MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN
LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLTTDKGEWLLYRA
HVKGESTEALLPNMVATSLAKLPIPKLMRWGASDVHFVRPVHTVTLLLGDKVIPATILGI
QSDRVIRGHRFMGESEFTIDNADQYPEILRERGKVIADYEERKAKIKADAEEAARKIGGN
ADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPSEALVYTMKGDQKYFPVYANDGKLLPN
FIFVANIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKKRLEDNLPRLQTVLFQQQLGT
LRDKTDRIQALAGWIAEQIGADVNHATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHD
GEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKMDTLAGIFGIGQHPKGDKDPFAL
RRAALGVLRIIVEKNLNLDLQTLTEEAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEG
YTVDTIQAVLARRPTRPADFDARMKAVSHFRTLDAAAALAAANKRVSNILAKSDEVLSDR
VNASTLKEPEEIKLAMQVVVLRDKLEPYFAEGRYQDALVELAELREPVDAFFDKVMVMVD
DKELRLNRLTMLEKLRELFLRVADISLLQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacttttctggtggaaatcggcactgaagagctgccaccaaaagcacta
cgcagcctggctgagtcctttgctgcgaactttactgcggagctggataacgctggcctc
gcacacggcaccgttcaatggtttgctgctccgcgtcgtctggcgctgaaagtagctaac
ctggcggaggcgcaaccggatcgcgaaatagaaaaacgcggcccggcaattgcccaggcg
ttcgacgctgaaggcaaaccgagcaaagcggcagaaggttgggcgcgtggttgcggtatt
accgttgaccaggctgagcgtctgactaccgataaaggcgaatggctgctgtatcgcgcc
catgtgaagggcgaaagcaccgaagcactgctgccgaatatggttgcgacttcgctggcg
aaactgccgatcccgaaactgatgcgttggggcgcaagcgacgtgcacttcgtgcgtccg
gttcacaccgtgaccctgctgctgggcgacaaagtaattccggctaccattctgggtatt
cagtccgatcgcgtgattcgcggccaccgctttatgggcgagtcggaattcactatcgac
aatgccgatcagtatccggaaattctgcgtgagcgcgggaaagtcatcgccgattacgaa
gaacgtaaggcgaagattaaagccgatgctgaagaagcagcacgtaagattggcggtaac
gctgatttaagcgaaagcctgctggaagaagtggcttcgctggtggagtggccggtcgtt
ctgaccgcgaaattcgaagagaaattcctcgcggtgccgtctgaagcactggtttacacc
atgaaaggtgaccagaagtacttcccggtgtatgcgaacgacggcaaactgctgccgaac
tttatcttcgttgccaacatcgaatcgaaagatccgcagcagattatctccggtaacgag
aaagtcgttcgtccacgtctggcggatgccgagttcttcttcaataccgaccgtaaaaaa
cgtcttgaagataacctgccgcgcctgcaaaccgtgttgttccagcaacagttggggacg
ctgcgcgacaaaactgaccgcattcaggcgctggctggctggattgctgagcagattggc
gctgacgttaaccacgctacccgtgcgggcctgctgtctaagtgtgacctgatgaccaac
atggtcttcgagttcaccgacacccagggcgttatggggatgcactacgcgcgtcacgat
ggcgaagcggaagatgtcgcggtggcgctgaatgagcagtatcagccgcgctttgccggt
gatgacctgccgtccaacccggtagcctgtgcgctggcgattgctgacaagatggatacc
ctggcgggtatcttcggtatcggtcagcatccgaaaggcgacaaagacccgtttgcgttg
cgtcgtgccgcacttggcgtgctgcgtattatcgttgagaagaacctcaaccttgatctg
caaacgctgaccgaagaagcggtgcgtctgtatggcgataagctgactaatgccaacgtg
gttgatgatgttatcgactttatgctcggtcgcttccgcgcctggtatcaggacgaaggt
tacaccgttgataccatccaggcggtactggcgcgtcgtccgacgcgtccggcagatttc
gatgcccgtatgaaggcggtatcgcatttccgtaccctggatgcagctgctgcactggcg
gcggcgaacaaacgtgtatccaacattctggcgaaatctgacgaagtgctgagcgaccgc
gtgaatgcttctaccctgaaagagccggaagaaattaaactggcgatgcaggttgtggtg
ctacgtgacaagctggagccgtactttgcggaaggtcgttaccaggatgcgctggtcgaa
ctggcagagctgcgtgagccagttgatgctttcttcgataaagtgatggtcatggttgat
gacaaagaattgcgtctcaaccgtctgaccatgctggagaaactgcgcgaactgttcctg
cgagttgcggatatttcgctgttgcagtaa

DBGET integrated database retrieval system