KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17720Help
Entry
NRG857_17720      CDS       T02068                                 

Gene name
glyQ
Definition
(RefSeq) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00970  Aminoacyl-tRNA biosynthesis
Module
eln_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:eln00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NRG857_17720 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eln01007]
    NRG857_17720 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eln03016]
    NRG857_17720 (glyQ)
Enzymes [BR:eln01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     NRG857_17720 (glyQ)
Amino acid related enzymes [BR:eln01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   NRG857_17720 (glyQ)
Transfer RNA biogenesis [BR:eln03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NRG857_17720 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-GeneID: 12876586
NCBI-ProteinID: YP_006121886
UniProt: A0A0H3EQC8
Position
complement(3748789..3749700)
Genome map
AA seq 303 aa AA seqDB search
MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ
PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN
WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV
YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENPL
PLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREALGFPMCN
KDK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtttgataccaggaccttccagggcttgatcctgaccttacaggattactgg
gctcgccagggctgcaccattgttcaaccattggacatggaagtcggcgcgggaacctct
cacccaatgacctgtctgcgcgcgctggggccagaaccgatggcggctgcttatgttcag
ccttctcgtcgcccgaccgatggtcgctacggcgaaaaccccaaccgtttacagcactac
tatcagttccaggtggtcattaaaccatcgccggacaatattcaggagctgtacctcggt
tctctgaaagagctgggcatggacccgaccatccacgacatccgtttcgtggaagataac
tgggaaaacccgacgctgggtgcctgggggctgggctgggaagtgtggctaaacggcatg
gaagtgacgcagttcacttacttccagcaggttggtggtctggaatgtaaaccggttacc
ggtgagatcacctacggtctggaacgtctggccatgtacattcagggcgtagacagcgtt
tacgacctggtctggagcgacggcccgctgggtaaaaccacctacggcgacgtgttccat
cagaacgaagtggagcagtccacttacaacttcgaatacgcggatgtggacttcctgttc
acctgcttcgagcagtacgagaaagaagcgcagcaactgctggcgctggaaaatccgctg
ccgctgccagcctacgagcgtattctgaaagccgcccacagcttcaacctgctggatgcg
cgtaaagccatctccgtcaccgagcgtcagcgctatattctgcgcattcgcaccctgacc
aaagcagtggcagaagcatactacgcttcccgtgaagccctcggcttcccgatgtgcaac
aaagataagtaa

DBGET integrated database retrieval system