KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17730Help
Entry
NRG857_17730      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3
Motif
Other DBs
NCBI-GeneID: 12876588
NCBI-ProteinID: YP_006121888
UniProt: A0A0H3ER28
Position
3750278..3751273
Genome map
AA seq 331 aa AA seqDB search
MQPKIYWIDNLRGIACLMVVMIHTTTWYVTNAHSVSPVTWDIANVLNSASRVSVPLFFMI
SGYLFFGERSAQPRHFLRIGLCLLFYSAIALLYIALFTSINMELALKNLLQKPVFYHLWF
FFAIAVIYLVSPLIQVKNVGGKMLLVLMVVIGIIANPNTVPQKIDGFEWLPINLYINGDT
FYYILYGMLGRAIGMMDTQHKALSWVSAALFATGVFIISRGTLYELQWRGNFADTWYLYC
GPMVFICAIALLTLVKNTLYTRTICGLGLISRHSLGIYGFHALIIHALRTRGIELKNWPI
LDIIWIFCATLAASLLLSMLVQRIDRNRLVS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccaaaatttactggattgataacctgcgagggatagcgtgtttaatggtggtg
atgattcacaccaccacctggtatgtgaccaatgctcatagtgttagccccgtcacatgg
gatatcgccaatgttctgaattctgcctctcgtgtcagcgtgccgctatttttcatgatt
tccggctatctcttttttggcgaacgcagcgcccagccgcgccatttcttgcgtatcggc
ttatgtctgcttttttatagcgcaatcgcactgctctacattgcgctgtttacctccatc
aatatggagttagcgctgaaaaacctgctgcaaaagccagtgttttaccatttatggttt
ttcttcgcgattgcagtgatttatctggtttcaccgctgattcaggtgaagaacgtcggc
ggaaaaatgttgctggtgctaatggtggtgattggtatcatcgctaacccaaatactgtg
ccgcagaaaatcgacggttttgaatggctgccaattaacttatatatcaatggcgatact
ttttactacatcctttatggcatgttgggccgcgctatagggatgatggacacacagcat
aaagcactgtcgtgggtgagcgccgcactgtttgcgacgggggtttttattatctctcgc
gggacattatatgaattacagtggcgcggaaattttgccgatacctggtatctttactgt
gggccgatggtttttatctgcgcaatcgcgttattgactctggttaaaaacacgctgtat
acgcgtaccatttgcggacttggcttaatctcccgccattcgttaggtatatacgggttc
catgcattgattatccatgcactgcgcacccgggggattgagcttaaaaactggccaata
ctcgatattatttggatcttttgcgcgacgttggcagcgagtttgttactttctatgctg
gtacaacgaatcgacagaaacagattagtgagttag

DBGET integrated database retrieval system