KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17735Help
Entry
NRG857_17735      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YiaAB MARVEL DUF4956 Claudin_2 DUF1218
Motif
Other DBs
NCBI-GeneID: 12876589
NCBI-ProteinID: YP_006121889
UniProt: A0A0H3ENA3
Position
complement(3751314..3751751)
Genome map
AA seq 145 aa AA seqDB search
MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQK
TVRDKYEGIPTTPIYYMTCLTVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVA
VQKNIRDAGINPPKETQVTQEEYSE
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaaaatatcaacctattctccggcatttagtattgtttcatgggtagccctt
attggcggtattgttacctatctgttaggactatggaatgcagagatgcagttaaatgaa
aaagggtattattttgccgtactggtattaggtttgttttccgcggcgtcttatcaaaag
accgttcgggacaagtatgaaggcatacctaccacccccatttattatatgacttgcctg
acggtctttattatctctgttgcgttgttgctggtaggtctatggaatgcaacgttatta
ctcagcgaaaaaggcttttatgggctggctttcttcttaagcttgtttggtgcagtagcg
gtgcagaagaatattcgtgatgccggaataaacccaccaaaagaaacacaggttacccag
gaagaatacagcgaataa

DBGET integrated database retrieval system