KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17745Help
Entry
NRG857_17745      CDS       T02068                                 

Definition
(RefSeq) xylulokinase
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00040  Pentose and glucuronate interconversions
eln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NRG857_17745
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     NRG857_17745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG NMO
Motif
Other DBs
NCBI-GeneID: 12876591
NCBI-ProteinID: YP_006121891
UniProt: A0A0H3EQD4
Structure
PDB: 

Position
complement(3752307..3753761)
Genome map
AA seq 484 aa AA seqDB search
MYIGIDLGTSGVKVILLNEQGEVVAAQTEKLTVSRPHPLWSEQDPEQWWQATDRAMKALG
VQHSLQDVKALGIAGQMHGATLLDAQQRVLRPAILWNDGRCAQECTLLEARVPQSRVITG
NLMMPGFTAPKLLWVQRHEPEIFRQIDKVLLPKDYLRLRMTGEFASDMSDAAGTMWLDVA
KRDWSDLMLQACHLSRDQMPALYEGSEITGALLPEVAKAWGMAAVPVIAGGGDNAAGAVG
VGMVDANQAMLSLGTSGVYFAVSEGFLSKPESAVHSFCHALPQRWHLMSVMLSAASCLDW
AAKLTGLSNVPALITAAQQADESAEPVWFLPYLSGERTPHNNPQAKGVFFGLTHQHGPNE
LARAVLEGVGYALADGMDVVHACGIKPQSVTLIGGGARSEYWRQMLADISGQQLDYRTGG
DVGPALGAARLAQIAANPEKSLIELLPQLPLEQSHLPDAQRYAAYQPRRETFRRLYQQLL
PSMA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcgggatagatcttggcacctcgggcgtaaaagttattttgctcaacgagcag
ggtgaggtggttgctgcgcaaacggaaaagctgaccgtttcgcgcccgcatccactctgg
tcggaacaagacccggaacagtggtggcaggcaactgatcgcgcaatgaaagctctgggc
gttcagcattctctgcaagacgttaaagcattaggtattgccggacagatgcacggtgca
accttactggatgctcagcaacgggtgttacgccctgccattttgtggaacgacgggcgc
tgtgcgcaagagtgcactttgctggaagcgcgagttccgcaatcgcgggtgattaccggc
aacctgatgatgcccggatttactgcgcctaaattgctatgggttcagcggcatgagccg
gagatattccgtcaaatcgataaagtattattaccgaaagattacttgcgtctgcgtatg
acgggggagtttgccagcgatatgtctgacgcagctggcactatgtggctggatgtcgca
aagcgtgactggagcgatctcatgctgcaggcttgccacttatctcgtgaccagatgccc
gcattatacgaaggcagcgaaattactggtgctttgttacctgaagttgcgaaagcgtgg
ggtatggcggcggtgccagttatcgcaggcggtggcgacaatgcagctggtgcggttggt
gtgggaatggttgatgctaatcaggcaatgttatcgctggggacgtcgggggtctatttt
gctgtcagcgaagggttcttaagcaagccagaaagcgccgtacatagcttttgccatgcg
ttaccgcaacgttggcatttaatgtctgtaatgctgagtgcggcttcgtgtctggattgg
gccgcgaaattaaccggcctgagcaatgtccctgctttaatcaccgcagctcaacaggct
gatgaaagtgccgagccagtttggtttctgccttatctttccggcgagcgtacaccacac
aataatccccaggcgaaaggggttttctttggtttgactcatcaacatggccccaatgaa
ctggcgcgagcagtgctggaaggcgtgggttatgcgctggcagatggcatggatgtcgtg
catgcctgcggcattaaaccgcaaagtgttacgttgattggtggcggggcgcgtagtgag
tactggcgtcaaatgctggcggacatcagcggtcagcaactggattaccgcacgggtggc
gatgtggggccagcactgggcgcagcaaggctggcgcagattgcggcgaatccagagaaa
tcgctcattgagttgttgccgcaactaccgttagaacagtcgcatctaccagatgcgcag
cgttatgccgcttatcagccacgacgagaaacgttccgtcgcctctatcagcaacttctg
ccatcaatggcgtaa

DBGET integrated database retrieval system