KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17755Help
Entry
NRG857_17755      CDS       T02068                                 

Gene name
xylF
Definition
(RefSeq) D-xylose transporter subunit XylF
  KO
K10543  D-xylose transport system substrate-binding protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln02010  ABC transporters
Module
eln_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NRG857_17755 (xylF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17755 (xylF)
Transporters [BR:eln02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    NRG857_17755 (xylF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3
Motif
Other DBs
NCBI-GeneID: 12876593
NCBI-ProteinID: YP_006121893
UniProt: A0A0H3ER32
Structure
PDB: 

Position
3755521..3756513
Genome map
AA seq 330 aa AA seqDB search
MKIKNILLTLCTSLLLTNVAAHAKEVKIGMAIDDLRLERWQKDRDIFVKKAESLGAKVFV
QSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQEGIKVLAYDRMINDAD
IDFYISFDNEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGK
IKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVA
ISGQDADLAGIKRIAAGTQTMTVYKPITLLANTAAEIAVELGNGQEPKADTTLNNGLKDV
PSRLLTPIDVNKNNIKDTVVKDGFHKESEL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagaacattctactcaccctttgcacctcacttctgcttaccaacgttgcg
gcacacgccaaagaagtcaaaataggtatggcgattgatgatctccgtcttgaacgctgg
caaaaagatcgagatatttttgtgaaaaaagcagaatctctcggcgcgaaagtatttgta
cagtctgcaaatggcaatgaagaaacacaaatgtcgcagattgaaaacatgattaaccgg
ggtgtcgatgttcttgtcattattccttataacggtcaggtattaagtaacgttgtaaaa
gaagccaaacaagaaggtattaaagtattagcttacgaccgtatgattaacgatgcggat
atcgatttttatatttctttcgataatgaaaaagtcggtgaactgcaggcaaaagccctg
gtcgatattgttccgcaaggtaattacttcctgatgggcggctcgccggtagataacaac
gccaagctgttccgcgccgggcaaatgaaagtattaaaaccttatgttgattccggaaaa
attaaagtcgttggtgaccaatgggttgatggctggttaccggaaaacgcattgaaaatt
atggaaaacgcgctaaccgccaataataacaaaattgatgctgtagttgcctcaaacgat
gccaccgcaggaggggcaattcaggcattaagcgcgcaaggtttatcagggaaagtagca
atttccggccaggatgcggatcttgcaggtattaaacgtattgctgccggtacgcaaact
atgacggtgtataaacctattacattgttggcaaatactgccgcagaaattgccgttgag
ttgggcaatggtcaggagccaaaagcggataccacactgaataatggcctgaaagatgtt
ccctcccgcctgctgacaccgatcgatgtgaataaaaacaacatcaaagatacggtagtt
aaagacggattccacaaagagagcgagctgtaa

DBGET integrated database retrieval system