KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17795Help
Entry
NRG857_17795      CDS       T02068                                 

Definition
(RefSeq) DNA-binding transcriptional repressor
  KO
K21602  IclR family transcriptional regulator, carbohydrate utilization repressor
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eln03000]
    NRG857_17795
Transcription factors [BR:eln03000]
 Prokaryotic Type
  Helix-turn-helix
   IclR family
    NRG857_17795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR MarR_2 Rrf2 TrmB ApoA-II HTH_24
Motif
Other DBs
NCBI-GeneID: 12876601
NCBI-ProteinID: YP_006121901
UniProt: A0A0H3EQE6
Structure
PDB: 

Position
complement(3765987..3766835)
Genome map
AA seq 282 aa AA seqDB search
MGKEVMGKKENEMAQEKERPAGSQSLFRGLMLIEILSNYPNGCPLAHLSELAGLNKSTVH
RLLQGLQSCGYVTTAPAAGSYRLTTKFIAVGQKALSSLNIIHIAAPHLEALNIATGETIN
FSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMAFGHPDYVKSYWESHQ
HEIQPLTRNTITELPAMFDELAHIRESGAAMDREENELGVSCIAVPVFDIHGRVPYAVSI
SLSTSRLKQVGEKNLLKPLRETAQAISNELGFTVRDDQGAIT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagaagtgatgggaaaaaaagagaacgagatggcgcaggaaaaagagcgccca
gccggaagccagagtctgtttcgtgggttgatgctgattgagattttgagcaactatcca
aacggttgtccgttggcgcatctttcggagctggctggtttaaataagagtaccgtccat
cgcttattgcagggattacagtcctgcggctatgtgaccaccgcgcccgccgcagggagt
tatcgcctgaccaccaaatttattgccgtcgggcagaaggcgctatcttcgctgaatatc
attcatatcgccgctccgcatcttgaggctctgaacatcgccactggtgaaactattaac
ttctccagccgcgaagacgatcacgctattttgatttataagctggaacccacaaccggg
atgctgcgaacccgtgcctatataggccagcatatgccgctctactgttccgcaatgggc
aagatctacatggcgtttggtcacccggactacgtgaagtcatactgggaaagccatcag
catgagatccagccgttaacccgcaataccattaccgagctgcccgcgatgttcgacgaa
ctggcgcacattcgtgaaagtggagcggcgatggacagagaagaaaacgaactcggcgtc
tcctgtattgctgttccggtgtttgatattcatgggcgggtgccgtacgccgtgtcgatt
tcgctttcgacatcacgtctgaaacaggtgggagagaaaaatctcctgaaaccacttcgt
gaaaccgcgcaggctatttctaatgaactgggatttactgtcagggacgaccagggcgcg
attacataa

DBGET integrated database retrieval system