KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17830Help
Entry
NRG857_17830      CDS       T02068                                 

Definition
(RefSeq) L-xylulose kinase
  KO
K00880  L-xylulokinase [EC:2.7.1.53]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00040  Pentose and glucuronate interconversions
eln00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NRG857_17830
   00053 Ascorbate and aldarate metabolism
    NRG857_17830
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.53  L-xylulokinase
     NRG857_17830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-GeneID: 12876608
NCBI-ProteinID: YP_006121908
UniProt: A0A0H3ER50
Position
3772317..3773813
Genome map
AA seq 498 aa AA seqDB search
MTQYWLGLDCGGSWLKAGLYDREGREAGVQRLPLCALSPQPGWAERDMAELWQCCTAVIR
ALLTHSGVSGEQIVGIGISAQGKGLFLLDKNDKPLGNAILSSDRRAMEIVRRWQEDGIPE
KLYPLTRQTLWTGHPVSLLRWLKEHKPERYAQIGCVMMTHDYLRWCLTGVKGCEESNISE
SNLYNMSRGEYDPCLTDWLGIAEINHALPPVVGSAEICGEITAQTAVLTGLKAGTPVVGG
LFDVVSTALCAGLEDEFTLNAVMGTWAVTSGITHGLRDGEAHPYVYGRYVNDGQFIVHEA
SPTSSGNLEWFTAQWGEISFAEINQAVASLPKAGGDLFFLPFLYGSNAGLEMTSGFYGMQ
AIHTRAHLLQAIYEGVVFSHMTHLNRMRERFTDVHTLRVTGGPAHSDVWMQMLADVSGLR
IELPQVEETGCFGAALAARVGTGVYRDFSEAQRDLQHPVRTLLPDMAAHQLYQQKYQRYQ
HLIAALQGYHAHIKEHTL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatactggctggggttagattgtggcggtagctggctgaaagccgggctgtat
gaccgagaaggccgggaggcgggcgtgcagcgcctgccgctgtgcgcattaagtccacag
ccaggctgggcagagcgcgacatggcagaactgtggcaatgttgcactgctgtcattcgc
gccctgcttacccattccggcgtcagcggggaacaaattgtcggtatcggcatctccgcg
cagggaaagggcttatttctacttgataaaaacgacaaaccgctcggtaacgccattttg
tcctcggatcgccgggcgatggaaatcgttcgtcgctggcaggaagatggcatcccggaa
aaactctatccgctgacccgacaaaccttatggaccgggcatccggtgtcgctgttacgc
tggctgaaagagcacaaaccagaacgctacgcgcaaattggctgcgtgatgatgacgcac
gactacctgcgctggtgtttaaccggcgtcaaaggttgcgaagagagcaatatttctgag
tccaatctctacaacatgagtcgcggggaatatgacccgtgccttaccgactggctgggg
attgctgaaatcaatcacgccctgccgcctgttgtcggatctgccgaaatctgcggggaa
atcaccgctcagacagccgtactgaccggtctgaaagcgggtacccccgttgtcggcggc
ctgtttgatgtggtttccaccgcactctgcgccgggctcgaagacgaattcaccctcaat
gcggtgatggggacctgggcggtgaccagcggcataacccacggtttacgtgacggtgaa
gcgcatccgtatgtctatggtcgctacgttaacgatggtcaatttatcgttcacgaagcc
agccccacctcttccggcaatctcgaatggtttaccgcacagtggggagaaatctcattt
gctgagattaatcaggccgttgccagtttgccgaaagccggtggcgatctctttttcctg
ccgttcctgtacggcagcaacgccggactcgaaatgaccagcggtttctacgggatgcag
gccattcacacccgtgcacacctcttacaggctatctatgaaggggtggtgttcagccat
atgacccatctcaaccggatgcgcgaacgttttactgatgtgcacaccctgcgcgtcact
ggcggcccggcgcactccgatgtctggatgcaaatgctggcggacgtcagcggtctgcgt
atcgagctgccgcaggtggaagaaaccggctgctttggtgcggcacttgccgcccgcgtc
ggtaccggggtttatcgcgatttcagcgaagcccaacgtgacttacagcacccggtacgc
accctgctgccggatatggccgcgcatcagctttaccaacaaaaataccaacgctatcaa
catctcattgccgcacttcagggttatcacgcccacatcaaggagcacacattatga

DBGET integrated database retrieval system