KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17855Help
Entry
NRG857_17855      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fic HTH_DeoR MarR_2 Sigma70_r4 HTH_11 HTH_IclR HTH_5 DUF2089 Sigma70_r4_2
Motif
Other DBs
NCBI-GeneID: 12876613
NCBI-ProteinID: YP_006121913
UniProt: A0A0H3ER57
Position
complement(3777707..3779002)
Genome map
AA seq 431 aa AA seqDB search
MAIKSPPGLIPLSHLSGEELLAHLRFNRVTDEKGRYLPFDELQYRIKKGENVDVAWTLTR
LARNAAIQRINYCNEAGEQAGFNITPVIAEACELVDKRATALALKDQTERLRGAGAELSQ
LRLEEPITSSQLEGANTTTLVARKMLETGRSPRTEDEHMIAGNARLMAEIPHLLAEPLTP
ALIRQLHAIGMGGINDAKYRPGEFRETDDVVIADYDGNIVHQPPAAALLPERLEKVCQWL
NSHEGYIHPLVRACILHFMLAHEHPFRDGNGRTSRALFYWYMLKSGYDVFKYISISRLLH
AAPVKYAASYQYTESDGMDLTYFLEYQAGVIKRALQNWQQHIDEITQRSAKLDSVLFSSG
VLKRLNPRQVTLLNVMLANPGKEYTVAEISASLGVSDNTARADLRTIVKEGFAQEKRINN
QQAVYVAHYPL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaatcacctcccggacttattcctttatcacacttatcgggtgaggaactc
ctggcccacctgcgctttaaccgggttaccgatgaaaaaggacgttatctgccttttgat
gagttgcagtaccgcatcaaaaaaggagaaaacgtcgatgtggcgtggacgcttacccgt
ctggcgcgcaacgcggcgatccaacgaattaactattgcaatgaagcgggtgaacaggcc
ggattcaacattaccccggtgattgcagaagcgtgcgagcttgtcgacaaacgtgctacc
gcgctggcgctgaaagatcagactgaacggttacgcggggccggagccgagttaagccag
ttacgcctggaagagccgatcaccagctcccagctggaaggtgcgaatactacaacgctg
gtggcgagaaaaatgctggaaacagggcggtcgccacgcactgaagacgagcatatgatt
gcgggaaatgcccggctgatggcggaaattccgcacttactcgcagaaccgctgacacct
gcgcttattcgccagttacatgccattggtatgggtggaatcaatgacgcgaaatatcgt
ccgggagaatttcgtgaaacagatgatgttgtgatcgccgactatgatggcaatatagtg
catcaaccgcccgctgcggcattgttaccggaacggctggaaaaagtttgccagtggtta
aacagccatgaagggtatattcatccgttggtccgtgcctgcattctgcattttatgctg
gcccatgaacatccgtttcgggatggcaacgggcgcaccagtcgggcgctgttttactgg
tatatgctgaaatcgggctacgatgtctttaaatatatttccatcagccgtttgcttcat
gctgcaccggtcaaatatgccgccagctaccagtacactgaatcagatggtatggatctg
acttatttccttgaatatcaggcgggtgtcattaaacgtgctctgcaaaactggcagcag
catatcgatgaaattacacaacgaagcgcaaaactcgatagtgtgctgtttagctctggt
gtgcttaaacgcctgaatccgcgccaggtaacgctcctgaatgtgatgctcgccaatccg
gggaaagagtacacagttgctgaaattagcgcgagcttgggcgtctctgataatacggct
cgagctgatttacggacaattgttaaagaaggattcgcgcaagagaaaagaattaataac
cagcaagcagtgtacgtcgcacactacccgctgtag

DBGET integrated database retrieval system