KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17875Help
Entry
NRG857_17875      CDS       T02068                                 

Definition
(RefSeq) putative glutathione S-transferase
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C GST_N_2 GST_N
Motif
Other DBs
NCBI-GeneID: 12876617
NCBI-ProteinID: YP_006121917
UniProt: A0A0H3EN08
Structure
PDB: 

Position
complement(3783804..3784412)
Genome map
AA seq 202 aa AA seqDB search
MKLVGSYTSPFVRKLSILLLEKGITFEFINELPYNADNGVAQFNPLGKVPVLVTEEGECW
FDSPIIAEYIELMNVAPEMLPRDPLESLRVRKIEALADGIMDAGLVSVREQARPAAQQSE
DELLRQREKINRSLDVLEGYLVDGTLKTDTVNLATIAIACAVGYLNFRRVAPGWCVDRPH
LVKLVENLFSRESFARTEPPKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtcggtagctacaccagcccgtttgtacgcaaactttctattctgttgtta
gaaaagggcataacgttcgaatttattaatgaactgccctataacgcggataacggcgtg
gcgcaatttaacccgttaggaaaagtgccggtgctggtgaccgaagagggcgaatgctgg
tttgattcgccgatcatcgctgaatatattgaattaatgaatgttgctccggagatgttg
ccgcgcgatccgctggagtcgttgcgggtgcgcaaaattgaggcactggcggatggcatt
atggatgccgggctggtatcggtgcgtgaacaggcgcgtccggcggcgcagcagtctgaa
gatgaattgttacgtcagcgtgagaaaatcaaccgcagtctggatgtgctggaaggatat
ctggtcgatggcacgctcaaaaccgatacggtcaatctggcgactatcgccattgcctgt
gccgtcggatatctcaatttccgccgcgttgcgccaggctggtgtgtcgaccgcccacac
ttagtcaaactggtcgaaaacctgtttagccgcgaaagttttgctcgcaccgaaccgcca
aaggcttga

DBGET integrated database retrieval system