KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17890Help
Entry
NRG857_17890      CDS       T02068                                 

Definition
(RefSeq) fused mannitol-specific PTS enzymes: IIA components; IIB components; IIC components
  KO
K02798  PTS system, mannitol-specific IIA component [EC:2.7.1.197]
K02799  PTS system, mannitol-specific IIB component [EC:2.7.1.197]
K02800  PTS system, mannitol-specific IIC component
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00051  Fructose and mannose metabolism
eln02060  Phosphotransferase system (PTS)
Module
eln_M00274  PTS system, mannitol-specific II component
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NRG857_17890
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    NRG857_17890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17890
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     NRG857_17890
Transporters [BR:eln02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component [MD:M00274]
    NRG857_17890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-GeneID: 12876620
NCBI-ProteinID: YP_006121920
UniProt: A0A0H3ENE1
Structure
PDB: 

Position
3786521..3788434
Genome map
AA seq 637 aa AA seqDB search
MSSDIKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLL
PLLIGYTGGKLVGGERGGVVGAITTMGVIVGADMPMFLGSMIAGPLGGWCIKHFDRWVDG
KIKSGFEMLVNNFSAGIIGMILAILAFLGIGPVVEALSKMLAAGVNFMVVHDMLPLASIF
VEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAK
QSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSI
LAVLAMTPKGAYFANIAGVCAAMAVSFVVSAILLKTSKVKEEDDIEAAARRVQEMKAESK
GASPLSAGDVTNDLSHVRKIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNL
PPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTENEVKVKD
SLKDSFDDSSANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREK
LTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEH
IQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgatattaagatcaaagtgcaaagctttggtcgtttcctcagcaacatggtg
atgccaaatatcggcgcgtttatcgcgtggggtatcatcaccgcgttatttattccaaca
gggtggttaccgaacgaaacgctggcgaagctggtcgggccgatgatcacttatctcctg
ccgctgctgatcggttataccggtggtaagctggtaggcggcgaacgtggcggcgtagtc
ggtgccatcaccaccatgggcgttatcgtcggcgcagatatgccgatgttcctcggctct
atgattgcaggtccgctgggcggctggtgcattaagcacttcgaccgctgggtagacggt
aagatcaaatccggttttgaaatgctggtgaataacttctccgcaggcatcatcgggatg
atcctcgctattctggcatttctcggcattggcccggttgttgaagccctgtctaaaatg
ctggcggcgggcgttaacttcatggttgtccatgacatgctgccgctggcgtctatcttt
gttgaaccggcgaaaatcctgttcctcaacaacgccattaaccacggtatcttctcgccg
ctgggtattcagcagtcccatgaactgggtaaatccatcttcttcctgattgaagctaac
ccaggtccgggtatgggcgtgctgctggcgtacatgttctttggtcgtggtagcgctaaa
cagtctgcgggcggtgcggcaatcatccacttcctgggcggtatccacgaaatctacttc
ccgtatgtgctgatgaatccgcgtctgattctggccgttatcctcggcggtatgactggc
gtgttcacgctgactatcctgggcggtggtctggtttctccggcatctccgggttctatc
cttgctgtactggcgatgacgccaaaaggtgcttacttcgctaacatcgcgggtgtgtgt
gcggcgatggcagtctccttcgttgtctctgccattctgctgaaaaccagcaaagtgaaa
gaagaagatgatattgaagctgctgcacgtcgcgttcaggaaatgaaagctgagtctaaa
ggcgcatctccgctgtctgcgggcgatgtgactaacgacctgagccacgtacgtaaaatc
atcgttgcctgtgatgccggtatgggttccagtgcgatgggtgcaggcgtgctgcgtaag
aaaattcaggatgcaggtctgtcgcagatttcggtcactaacagcgcgatcaacaacctg
ccgccagatgtggacctggtcatcactcaccgtgacctgaccgaacgcgctatgcgccag
gttccgcaggcacagcatatttcgctgaccaacttcctcgacagcggcctgtacaccagc
ctgaccgaacgtctggttgctgcccagcgccatactgaaaacgaagtgaaagtgaaagac
agtctgaaagacagctttgacgattccagtgctaacctgttcaaactaggcgcggagaac
atcttcctcggtcgcaaagcggccaccaaagaagaagcgattcgttttgctggcgagcag
ctggtgaaaggcggttacgttgagccggaatacgttcaggcgatgctggatcgtgaaaaa
ctgaccccgacttatctgggtgagtctatcgcggtgccacacggtacggttgaagcgaaa
gatcgcgtactgaaaacgggcgtcgtgttctgccagtacccggaaggcgtgcgcttcggt
gaagaagaagatgacattgcccgtctggtgattggtattgctgcccgtaacaacgagcac
attcaggtgatcaccagcctgaccaacgcactggatgatgagtccgttatcgagcgtctg
gcgcacaccaccagcgtggatgaagtgctggaactgctggcaggtcgtaagtaa

DBGET integrated database retrieval system