KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17915Help
Entry
NRG857_17915      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3251 TRAF_BIRC3_bd
Motif
Other DBs
NCBI-GeneID: 12876625
NCBI-ProteinID: YP_006121925
UniProt: A0A0H3ENE6
Position
3792014..3792697
Genome map
AA seq 227 aa AA seqDB search
MNLKKTLLSVLMILQLCLLVGCDYIEKASKVDDLVTQQELQKSKIEALEKQQELDKRKIE
HLEKQQTIIINSTKTLAGVVKAVKDKQDEFVFTEFNPAQTQYFILNNGSVGLAGKILSID
AVENGSVIRISLVNLLSVPVSNMGFYATWGGEKPTDINALAKWQQLLFSTSMNSSLKLLP
GQWQDINLTLKGVSPNNLKYLKLAINMANIQFDRLQPAESPQRKNKK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaaagaaaacactgttaagcgtgttaatgatattgcaactttgcttattggta
gggtgtgactatattgaaaaagcgagtaaggtcgacgacctcgttacacagcaagagttg
caaaaaagcaaaattgaggcgcttgaaaaacaacaagaactcgacaagcgcaagatagaa
caccttgaaaaacaacaaactatcattataaacagtaccaaaacactcgctggtgtggtg
aaggcagttaaagacaaacaggacgaatttgtctttacagaatttaacccggcacaaacc
caatacttcattttaaataacggttctgttggtttggcagggaaaatactgtctattgac
gcagtagaaaacggcagtgttattcgtatttcactggttaacttattaagtgttcctgta
tcaaatatgggtttttacgcgacatgggggggagaaaaacccaccgacatcaacgcatta
gcaaaatggcagcaattgctatttagtacctcaatgaactcctccctgaaattattacca
ggtcaatggcaagacattaatttgacgctaaaaggtgtctcgcccaacaacctcaaatat
ctgaaattagccatcaacatggcaaatattcagttcgaccgtcttcaacctgctgaatct
ccacagcggaaaaacaaaaaataa

DBGET integrated database retrieval system