KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17980Help
Entry
NRG857_17980      CDS       T02068                                 

Definition
(RefSeq) putative polysaccharide deacetylase
  KO
K09798  uncharacterized protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NRG857_17980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_2
Motif
Other DBs
NCBI-GeneID: 12876639
NCBI-ProteinID: YP_006121939
UniProt: A0A0H3ENI4
Position
3808651..3809610
Genome map
AA seq 319 aa AA seqDB search
MFPFRRNVLAFAALLALSSPVIAGKLAIVIDDFGYRPHNENQVLAMPSAISVAVLPDSPH
AREMATKAHNSGHEVLIHLPMAPLSKQPLEKNTLRPEMSSDEIERIIRSAVNNVPYAVGI
NNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDD
SQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPPDITLVKASSLLNE
PQVDTSTPPKNTVPDTPRNPFRGVKLCKPKKPLEPVYANRFFEVLSESISQSTLIVYFQH
QWQGWGKQPEAAKLNASAN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgtttccatttcgtcgtaacgttcttgcatttgccgctctgttggcgctctcctccccc
gtaattgctggcaaacttgccatcgtcattgatgattttgggtatcgcccgcacaacgaa
aaccaggtgctggcgatgccttccgctatctccgtcgctgtattacccgattcaccgcac
gccagagagatggcgaccaaagcgcataacagcggtcacgaagtgttgattcatctaccg
atggcaccactgagtaaacagccgctggagaaaaatacgctacgcccggagatgagcagc
gacgaaattgagcgcattattcgtagtgcggtcaataacgtgccctatgccgtggggatc
aacaaccacatgggcagcaagatgacctctaacctgtttggtatgcagaaagtgatgcag
gcgctggagcgttacaatctttacttcctcgacagcgtaaccatcggtaatacccaggcg
atgcgcgccgcgcaaggcactggcgtgaaggtgatcaaacggaaggtgttcctcgacgat
tcgcaaaatgaagcggacatccgtgtgcaatttaatcgcgcaattgacctggcacgtcgc
aacggttcaaccattgccattgggcatcctcacccttcaacggtacgcgtgctacaacag
atggtttataacctgccgccagacattacgctggtgaaagccagcagcttgctgaatgaa
ccgcaggttgatacgtctacaccgccgaaaaacactgtgcccgacacaccgcgtaatcca
ttccgtggcgtgaagctgtgcaaaccgaagaagccgctggaacctgtttatgctaatcgc
ttctttgaagtattaagcgaaagcatcagccagagcacgctgatcgtttacttccagcat
cagtggcaaggctggggcaaacagcccgaagcggcaaaacttaacgctagcgcaaattaa

DBGET integrated database retrieval system