KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17985Help
Entry
NRG857_17985      CDS       T02068                                 

Definition
(RefSeq) putative glycosyl transferase
  KO
K19354  heptose III glucuronosyltransferase [EC:2.4.1.-]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eln01003]
    NRG857_17985
   01005 Lipopolysaccharide biosynthesis proteins [BR:eln01005]
    NRG857_17985
Enzymes [BR:eln01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     NRG857_17985
Glycosyltransferases [BR:eln01003]
 Polysaccharide
  Bacterial polysaccharide
   NRG857_17985
Lipopolysaccharide biosynthesis proteins [BR:eln01005]
 Core region
  NRG857_17985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 12876640
NCBI-ProteinID: YP_006121940
UniProt: A0A0H3ENG1
Position
complement(3809597..3810631)
Genome map
AA seq 344 aa AA seqDB search
MMNSTNKLSVIIPLYNAGDDFLTCMESLITQTWTALEIIIINDGSTDNSVEIAKHYAENY
PHVRLLHQANAGASVARNRGIEVATGKYVAFVDADDEVYPTMYETLMTMALEDDLDVAQC
NADWCFRETGETWQSIPTDRLRSTGVLTGPDWLRMGLSSRRWTHVVWMGVYRRDVIVKNN
IRFIAGLHHQDIVWTTEFMFNALRARYTEQSLYKYYLHNTSVSRLHRQGNKNLNYQRHYI
KITRLLEKLNRNYADKITIYPEFHQQITYEALRVCHAVRKEPDILTRQRMIAEIFTSGMY
KRLITNVRSVKVGYQALLWSFRLWQWRDKTRSHHRITRSAFNLR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacagcaccaataaacttagtgttattattccgttatataatgcgggtgatgat
ttcctcacttgtatggaatctttaattacgcaaacctggactgctctggaaatcattatt
attaacgatggttcaacggataattctgttgaaatagcaaagcattacgcagaaaactat
ccgcacgttcgtttgttgcatcaggcgaatgctggcgcatcggtggcgcgtaatcgtggg
attgaagtggcaacgggaaaatatgtcgcttttgtcgatgctgacgatgaggtctatccc
accatgtacgaaacgctgatgaccatggcgttagaggacgacctcgacgtggcgcagtgc
aacgctgattggtgttttcgtgaaacgggtgaaacctggcaatccatccctaccgatcgc
cttcgctcaaccggtgtattaactggtccggactggctgcggatgggactttcttcccgc
cgttggacacacgtggtctggatgggggtttatcgccgcgatgttattgttaaaaataac
attagatttattgccggattacatcatcaggatattgtctggacaacagaatttatgttt
aacgcgctgcgtgcgcgatataccgagcaatcattatataaatattatctgcataatacg
tcagtgagtcggttgcatagacaagggaacaaaaaccttaattatcaacgtcactatatt
aagattacccgcctgctggagaaattaaatcgaaattatgctgacaaaattacgatttat
ccggaatttcatcagcaaataacctacgaagcattgcgtgtttgccatgcggtgcgcaaa
gagccggatattcttacccgccaacggatgattgccgagatatttacttccggtatgtat
aagcgcctgattactaatgtgcgcagcgtgaaggtgggttaccaggcgttactgtggtct
ttccgcttatggcaatggcgcgacaaaacgcggtcgcaccatcgcattacgcgtagcgcc
tttaatttgcgctag

DBGET integrated database retrieval system