KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_18135Help
Entry
NRG857_18135      CDS       T02068                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00230  Purine metabolism
eln01100  Metabolic pathways
Module
eln_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NRG857_18135 (gmk)
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NRG857_18135 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 AAA_16 AAA_22 ABC_tran AAA_33 AAA_18 AAA_29 Viral_helicase1
Motif
Other DBs
NCBI-GeneID: 12876749
NCBI-ProteinID: YP_006121970
UniProt: A0A0H3ENJ3
Structure
PDB: 

Position
3838795..3839418
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHD
EFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLK
TIIRAERLRMSRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacacccaggtttctgtttcacacacc
acacgccaaccgcgtcctggtgaagtccacggtgaacattatttctttgttaatcatgat
gaatttaaagaaatgattagtagagatgcgttcctcgaacacgcagaagtttttggtaat
tactatggcacttcgcgtgaggccattgagcaagtactggcgaccggtgtcgatgttttt
ctcgatatcgactggcagggtgcgcagcaaattcgccagaagatgccgcacgcgcggagt
atctttattttaccgccgtctaaaatcgaactggaccgccgtctacgcggtcgcggtcag
gacagcgaagaggtcattgcaaagcgtatggcgcaagctgttgcagaaatgagccattac
gccgaatatgattacctgattgtgaatgatgacttcgataccgcgttgaccgatttgaag
accattattcgcgccgaacgtctgcgcatgagccgccaaaagcagcgtcatgacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system