KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0210Help
Entry
EC042_0210        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion system protein
  KO
K06887  uncharacterized protein
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EC042_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP Sperm_Ag_HE2 PilN_bio_d
Motif
Other DBs
NCBI-ProteinID: CBG33042
UniProt: D3GS45
Position
complement(243529..244008)
Genome map
AA seq 159 aa AA seqDB search
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVMSLSHGLSRAQNVNHQELT
ITKPVDKSSPLLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLTNARISNIGLTVPHT
INDSPGQPEESVSFTYESINWEHIVAGTSAYSLWSERIF
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcccgtctatctgacactaaacggagaactccagggactgatttcatccgga
tgctcgtcaatgccgtccatcggtaacaaggcccagattgcacatcaggatcagatcatg
gtgatgtcactgtcccatgggctgagtcgcgcacagaacgtcaatcaccaggaactgact
atcacgaaaccggtggacaaatcctccccccttctgggcaaggccatttcggagaatgaa
tgtctgacctgtgattttgtcttctatcgcaccaaccgttttggtattaatgagccgtac
tacaagctgaaactgactaatgcccggatctcaaacatcggccttaccgttccccatacc
attaacgacagcccagggcagccggaagagtctgtgtcatttacctatgagagcatcaac
tgggagcacatcgtcgccggaaccagtgcgtacagtctgtggagtgaacggattttctaa

DBGET integrated database retrieval system