KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0216Help
Entry
EC042_0216        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion system protein
  KO
K11892  type VI secretion system protein ImpK
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_0216
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_0216
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU DUF2721
Motif
Other DBs
NCBI-ProteinID: CBG33048
UniProt: D3GS51
Position
complement(253871..254644)
Genome map
AA seq 257 aa AA seqDB search
MSDISDMGEPSVFPMEPESGTSGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAM
PEHLFAQVVTDVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSL
LVHFHNEAWGGEKVFILLERLIREPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERI
YQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQLIRRLTIRHVLCGGLVVLAVFYLFYLLR
LDSQTQDILHQLNKLLR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatcagcgatatgggtgaaccgtcggtttttcccatggagccggagagcgga
acatcaggacgtcagtaccgtctcgcccttcgcggcaacagcctgaacccaatgattgac
gccgccacgccgttgctcggcatggtgatgcgtctgtccaccatgaacagccaggccatg
ccggaacatctgtttgcccaggtggtaaccgatgtccaggctgtggaacaactactccag
gagcagggttacgagccgggcgtcattgtttcgttccgctacattctctgcacgtttatt
gacgaagcggcgctgggcaacggctggtccaacaaaaacgaatggataaaacagtcgcta
ctggttcatttccataacgaagcctggggcggcgagaaagtgtttatcctgctcgaacgc
ctgatccgggagccggtacgttaccaggatctgctggaatttttatacctctgcttttcg
ctgggctttcgcgggcgctacaaggttgccattcagcaacaggatgaatttgagcggatc
taccagcgcctgcaccatgccctgcacaaactgcgcggtgacgcgccatttccgctgctt
caccagaagaacaacatacagggcgggcgttatcagttaatccggcggctgaccatcagg
catgtactgtgcggcggtcttgttgtgctggccgtattttatctgttttatctgctgcgt
ctggacagccagacacaggatattctgcatcagctcaataaattactccgataa

DBGET integrated database retrieval system