KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0224
Entry
EC042_0224        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion system protein
  KO
K11901  type VI secretion system protein ImpB
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_0224
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_0224
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CBG33056
UniProt: D3GS59
Position
complement(262613..263116)
AA seq 167 aa
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIA
INRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRL
LELREALVALKSPLGNIPAFRAQLQALLENEDSREQLIQELGIAAQK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaaaatgaacaacaatggcggcagtgtcgcgccgaaagaaagaatcagcgttcgg
tatacaccaaaagttgatggggtggctgctgatatcgaattgccgctgaatttattgatc
accggcaatctgaaagggaaaccagataacacgccgttggacgagcgaactgccattgct
atcaaccgctataacctcaacgcagtcatttcagaagctgacattgaacgggagtttgtt
gttccggctgaactcagtgacgctcccaatgagcaaatgtacgtcaacctgaaagtcaaa
tctatggatgacctttctccggaccatattgccagccaggtaccagaaataaaacgtctg
ctcgaattgcgtgaagctctggtcgcacttaagtctccactaggcaatattccggccttc
cgcgcacaacttcaggcgctactggaaaacgaagacagccgcgagcagctgatccaagaa
ctgggtatcgccgctcagaaataa

DBGET integrated database retrieval system