KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0740Help
Entry
EC042_0740        CDS       T02067                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00020  Citrate cycle (TCA cycle)
elo00190  Oxidative phosphorylation
elo00650  Butanoate metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01120  Microbial metabolism in diverse environments
elo01130  Biosynthesis of antibiotics
elo01200  Carbon metabolism
Module
elo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
elo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EC042_0740 (sdhD)
   00650 Butanoate metabolism
    EC042_0740 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EC042_0740 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CBG33562
UniProt: D3GY61
Structure
PDB: 

Position
817569..817916
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggattggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system