KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0775Help
Entry
EC042_0775        CDS       T02067                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00010  Glycolysis / Gluconeogenesis
elo00260  Glycine, serine and threonine metabolism
elo00680  Methane metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01120  Microbial metabolism in diverse environments
elo01130  Biosynthesis of antibiotics
elo01200  Carbon metabolism
elo01230  Biosynthesis of amino acids
Module
elo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elo_M00002  Glycolysis, core module involving three-carbon compounds
elo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC042_0775 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EC042_0775 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EC042_0775 (gpmA)
Enzymes [BR:elo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EC042_0775 (gpmA)
Membrane trafficking [BR:elo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EC042_0775 (gpmA)
Exosome [BR:elo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EC042_0775 (gpmA)
  Exosomal proteins of melanoma cells
   EC042_0775 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: CBG33598
UniProt: D3GY97
Structure
PDB: 

Position
complement(856779..857531)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcagaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccacgttac
gcgaagctgagcgagaaagaactgccactgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtcatc
atcgccgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgactggtgtgccactggtgtatgagttcgacgag
aatttcaaaccgttgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggccgttgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system