KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1387Help
Entry
EC042_1387        CDS       T02067                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00260  Glycine, serine and threonine metabolism
elo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01130  Biosynthesis of antibiotics
elo01230  Biosynthesis of amino acids
Module
elo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EC042_1387 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EC042_1387 (trpB)
Enzymes [BR:elo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EC042_1387 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBG34209
UniProt: D3H3G5
Structure
PDB: 

Position
complement(1452827..1454020)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMHLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggcccagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcactcacc
aaatgccagaacatcacggctggcactaacaccacgctgtatctcaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcatttaatgggcgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaatgaggcgctgcgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagctggcccacatccttatccgaccatt
gtccgtgagttccagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgcctgccggatgcggttatcgcttgtgttggcggcggttcaaatgccatcggcatg
tttgctgatttcatcaacgaaaccgacgtcggcctgattggtgtggagcctggcggtcac
ggtatcgaaaccggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatt
tctgccggactggatttcccgtctgtcggcccacaacacgcgtatctcaacagcactggg
cgcgctgattatgtgtcaattaccgatgatgaagcactggaagccttcaaaacactctgc
ctgcacgaagggattatcccggcgctggagtcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaacccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagctcgaggggaaatctga

DBGET integrated database retrieval system