KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2263Help
Entry
EC042_2263        CDS       T02067                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00340  Histidine metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01230  Biosynthesis of amino acids
Module
elo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    EC042_2263 (hisD)
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EC042_2263 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE
Motif
Other DBs
NCBI-ProteinID: CBG35097
UniProt: D3GZ88
Structure
PDB: 

Position
2356887..2358191
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKARGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDAEMARRVAEAVERQLAELPRAETARQ
ALSASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARDLVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcactgttaacgatattctc
gataacgtgaaagcacgcggcgatgaggccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgctgaggagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaacattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtcgaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccggtggcttcagtgggtttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcgactccggcgcgtatagcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgaaattctttacgcggcgcagctgtgcggcgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcactggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccaggcaacgcctttgtcaccgaggcaaaacgccag
gtaagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctttcccaggct
gaacacggcccggactctcaggtgattttactgacgcccgatgctgagatggcgcgtcgc
gtagccgaagctgtcgaacgccaactggcagaactgccgagagctgaaaccgcccgccag
gcactgagcgccagccgcctgattgtgactaaagatttagcgcagtgcgtagagatctcc
aaccagtacggcccggagcacctgatcatccagacccgcaacgcccgcgatctggtcgat
ggcatcaccagcgccggttcggtatttctgggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgttctgccgacttacggttacactgccacctgttccagc
ctcgggctggcagatttccagaagcgcatgaccgtgcaggaactgtcgaaagaaggtttc
tccgcgctggcttcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system