KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2346Help
Entry
EC042_2346        CDS       T02067                                 

Gene name
metG
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00450  Selenocompound metabolism
elo00970  Aminoacyl-tRNA biosynthesis
elo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EC042_2346 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EC042_2346 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:elo01007]
    EC042_2346 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:elo03016]
    EC042_2346 (metG)
Enzymes [BR:elo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EC042_2346 (metG)
Amino acid related enzymes [BR:elo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EC042_2346 (metG)
Transfer RNA biogenesis [BR:elo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EC042_2346 (metG)
 Prokaryotic type
   Other AARSs
    EC042_2346 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: CBG35181
UniProt: D3GZX9
Structure
PDB: 

Position
2455532..2457565
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKKDSTAELYHFIGKDIVY
FHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFDGVLASELADPQLYK
TFTDAAEVIGEAWESREFGKAIREIMALADLANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMTYLKPVLPKLTERAEAFLNTELTWHGIQQPLLGHKVNPFKALYNRIDMKQV
EALVEASKEEVKAAATPVTGPLADDPIQETITFDDFAKVDLRVALIENAEFVEGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQALIGRHTIMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDAGAKPGHQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaagaaaattctggtgacgtgcgcactgccgtacgctaacggctca
atccacctcggccatatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccacgaggtcaacttcatctgcgccgacgatgcccacggcacaccgatcatg
ctgaaagctcagcagcttggtatcactccggagcagatgattggcgaaatgagtcaggag
catcagactgatttcgcaggctttaacatcagctacgacaactatcactcgacgcacagc
gaagagaaccgccagttgtcagaacttatttattctcgcctgaaagagaacggttttatt
aaaaaccgcaccatctctcagctttacgatccggaaaaaggcatgttcctgccggaccgt
tttgtaaaaggcacctgcccgaaatgtaaatccccggatcaatacggcgataactgcgaa
gtctgcggcgcgacctacagcccgactgaactgatcgagccgaaatcggtggtttctggc
gctacgccggtaatgcgtgattccgaacacttcttctttgatctgccctctttcagcgaa
atgttgcaggcatggacccgcagcggtgcgttgcaggagcaggtggcaaacaaaatgcag
gagtggtttgaatccggcctgcaacagtgggatatctcccgcgatgcgccgtacttcggt
tttgaaattccgaacgcaccgggcaaatatttctacgtctggctggacgcgccgattggc
tacatgggttccttcaagaatctgtgcgacaaacgcggcgacaccaccagcttcgatgaa
tactggaagaaagattccaccgccgagctgtaccacttcatcggtaaagatatcgtttac
ttccacagcctgttctggcctgccatgctggaaggcagcaacttccgcaagccgactaac
ctgtttgttcatggctatgtgacggtgaacggcgcgaagatgtccaagtctcgcggcacc
tttattaaagccagcacctggctgaatcattttgacgccgacagcctgcgttactactac
actgcgaaactttcttcgcgcattgatgatatcgatctcaacctggaagatttcgttcag
cgtgtgaatgccgatatcgtgaataaagtggttaacctggcctcccgtaacgcgggcttt
atcaacaagcgttttgacggtgtgctggcaagcgaactggctgacccgcaactgtacaaa
accttcacggatgccgctgaagtgattggtgaagcgtgggaaagccgcgaatttggtaaa
gcgatccgcgaaatcatggcgctggcagatctggctaaccgttatgtcgatgaacaggct
ccgtgggtggtggcgaaacaggaaggacgcgatgccgacctgcaggcaatttgctcgatg
ggcataaacctgttccgcgtgctgatgacttacctgaagccggtactgccgaaactgacc
gagcgtgcagaagcattcctcaatacagaactgacctggcatggtatccagcaaccgctg
ctgggccacaaagtgaatccgttcaaggcgctgtataaccgtattgacatgaagcaggtt
gaagcactggtggaagcgtctaaagaagaagtgaaagcagctgccacgccagtaactggc
ccactggcagatgatccgattcaggaaaccatcacctttgacgacttcgccaaagttgac
ctgcgcgtggcgttgatcgaaaacgcagagtttgttgaaggttctgacaaactgctgcgc
ctgacgctggatctcggcggtgaaaaacgcaatgtcttctccggcattcgttctgcttac
ccggatccgcaggcactgattggtcgtcataccattatggtggctaacctggcaccacgt
aaaatgcgcttcggtatctccgaaggcatggtgatggctgccggtcctggcgggaaagat
attttcctgctaagcccggatgctggtgctaaaccgggtcatcaggtgaaataa

DBGET integrated database retrieval system