KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2607Help
Entry
EC042_2607        CDS       T02067                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00010  Glycolysis / Gluconeogenesis
elo00052  Galactose metabolism
elo00500  Starch and sucrose metabolism
elo00520  Amino sugar and nucleotide sugar metabolism
elo00521  Streptomycin biosynthesis
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01120  Microbial metabolism in diverse environments
elo01130  Biosynthesis of antibiotics
elo01200  Carbon metabolism
Module
elo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC042_2607 (glk)
   00052 Galactose metabolism
    EC042_2607 (glk)
   00500 Starch and sucrose metabolism
    EC042_2607 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EC042_2607 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EC042_2607 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EC042_2607 (glk)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EC042_2607 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CBG35440
UniProt: D3H249
Structure
PDB: 

Position
complement(2764972..2765937)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaagcctattgcggtttacggtgccggaacggggcttggg
gttgcgcatctggtccatgtagataagcgttgggtaagcttgccaggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagagggcattatcctcgaaatactgcgtgcagaa
attggtcatgtttcggcagagcgcgtgctttctggtcctgggctggtgaatttgtatcgc
gcgattgtgaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgtgcgctggctgacagctgcaccgattgccgccgcgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggtggtatcgtgccgcgcttccttgagttcttcaaagcctccggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system