KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3077
Entry
EC042_3077        CDS       T02067                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00230  Purine metabolism
elo01100  Metabolic pathways
elo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC042_3077 (xdhA)
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     EC042_3077 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CBG35904
UniProt: D3GTN2
Position
3278312..3280570
AA seq 752 aa
MRVDAIAKVTGRARYTDDYVMAGMCYANYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
DVPDIPFATAGHAWTLDENKRDTADRVLLTRHVRHHGDAVAIVVARDELTAEKAAQLVSI
EWQELPVITTPEAALADDAAPIHNGGNLLKQSSMSTGNVQQTIDAADYQVQGHYQTPVIQ
HCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKPFVGGGFGNK
QDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLD
VLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFA
VESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRR
AECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTLNVQSGATEIGQGADT
VFSQMVAETVGVPVSDVRVISTQDTDITPFDPGAFASRQSYVAAPALRSAALLLKEKIIA
HAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTT
NPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEE
MIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAI
RNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcgcgtcgatgccattgctaaggtcaccgggcgggcacgatatactgacgattatgtt
atggcgggcatgtgttacgcgaattatgtacgtagccctatcgcacatggttatgccgta
agtattaatgatgaacaagccagaagtttaccaggcgtactggcgatttttacctgggaa
gatgtacctgatatcccattcgctacggctgggcatgcctggacacttgatgaaaacaag
cgcgataccgccgatcgcgtactgctaactcgccatgttcgtcatcatggtgacgccgtt
gccatcgtcgtggcccgtgatgaactcacggcagaaaaagcggcgcaattggtcagcatt
gagtggcaagaattacccgttatcaccacgccagaagcggcgctggcagatgacgctgca
ccaatccataacggcggcaatttactaaaacaaagctcgatgtcgacgggtaatgtccaa
caaacaatcgatgccgccgattaccaggtgcaggggcactatcagactcccgttattcaa
cattgtcatatggaaagcgtgacatcgctggcatggatggaggatgactctcgaattacc
atcgtttccagcacccagatcccgcacattgttcgccgcgtagttggtcaggcgctggat
attccctggtcatgcgtacgagttatcaaaccgtttgtcggtggcggttttggtaataaa
caggatgtgctggaagagccaatggcggcattcctgaccagcaagcttggcggcattccg
gtgaaagtttcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgctttt
actattgacgggcaaatgggcgtgaaccgcgacggaacattgaaaggttatagtctggat
gttctgtctaacaccggcgcttatgcatctcacgggcactccatcgcttctgcgggcgga
aataaagtcgcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctat
accaacctcccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgcc
gttgagtctatgcttgatgacgccgcgacagcgttaggtattgatcctgttgaaattcgt
ttacgcaacgccgcccgcgaaggagatgctaatccgctcacgggcaaacgtatttacagc
gcagggttgccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgt
gcagaatgccagaaccagcaaggcaatttacgccgcggcgttggcgtcgcctgttttagc
tacacctctaacacctggcctgtcggcgtagaaatagcaggcgcgcgccttctgatgaat
caggatggaaccctcaacgtacagagtggtgccacggaaatcggtcagggggccgacacc
gtcttctcgcaaatggtagcagaaaccgtgggggttccggtcagcgacgttcgcgttatt
tcaacccaagataccgacattacgccgttcgatcccggtgcatttgcctcacgccagagc
tatgttgccgcgcctgcgctgcgcagtgcggcactgttattaaaggagaaaatcatcgct
cacgccgctgtcatgctacatcagtcagcgatgaatcttaccctgataaaaggccatatc
gtgctggttgaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggatgcc
ttctaccaccctgaacgcggcgggcagctctctgccgaaagctccatcaaaaccaccact
aacccaccagcgtttggctgtacctttgttgatctgacggtcgatattgcgctgtgcaaa
gtcaccatcaaccgcatcctcaacgttcatgattcgggccatattcttaatccgttgctg
gcagaaggtcaggtacacggcggaatgggaatgggcattggctgggcgctatttgaagag
atgatcatcgatgcgaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatg
cccaccatgccggatctgccacaactggaaagcgcgtttgtcgaaatcaatgagccgcaa
tccgcatacggacataagtcactgggtgagccacccataattcctgttgccgctgctatt
cgtaacgcggtgaagatggctaccggtgttgcaatcaatacactgccgctgacgccaaaa
cggttatatgaagagttccatctggcaggattgatttga

DBGET integrated database retrieval system