KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3079
Entry
EC042_3079        CDS       T02067                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00230  Purine metabolism
elo01100  Metabolic pathways
elo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC042_3079 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CBG35906
UniProt: D3GTN4
Position
3281456..3281935
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLRDQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIINTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcatgccgctctcggaattactccgcgatcaaggactgttaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgcg
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggtctggcgggaaatctttgt
cgctgcacggggtatcagatgattataaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system