KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3312Help
Entry
EC042_3312        CDS       T02067                                 

Gene name
qseC
Definition
(GenBank) two-component system sensor kinase
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo02020  Two-component system
elo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC042_3312 (qseC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EC042_3312 (qseC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elo01001]
    EC042_3312 (qseC)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:elo02022]
    EC042_3312 (qseC)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EC042_3312 (qseC)
Protein kinases [BR:elo01001]
 Histidine kinases
  OmpR family
   EC042_3312 (qseC)
Two-component system [BR:elo02022]
 OmpR family
  QseC-QseB (quorum sensing)
   EC042_3312 (qseC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HAMP
Motif
Other DBs
NCBI-ProteinID: CBG36140
UniProt: D3GVT0
Structure
PDB: 

Position
3532441..3533790
Genome map
AA seq 449 aa AA seqDB search
MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL
NEINAADRMAQTPNKLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG
QLVGEDDPWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPIMLIIMMV
LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF
TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLD
SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNAHGIKRTGQPLLLSLLVRNL
LDNAVRYSPQGSVVDITLNADSFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS
IVQRIAKLHGMNVEFGNVEQGGFETKVSW
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacccaacgtcttagtctgcgagtcaggctgacgctaatctttttaattctg
gcctcagtgacctggctgctttccagctttgtcgcctggaaacaaacaacggataacgtc
gatgagttgttcgacacccaactgatgctgtttgccaagcggttaagtacgctcgatctc
aacgaaatcaacgcggcagatcgcatggcacagacgccaaataaattaaaacacggtcat
gttgatgacgatgcgctgacctttgccatctttacccacgacggcagaatggtccttaac
gatggcgataacggagaagatattccctatagctatcaacgggaaggttttgctgacggg
caactggtcggtgaagacgatccctggcgttttgtctggatgacctcacctgatggcaaa
tatcgcatcgttgttggtcaggaatgggaataccgcgaagacatggcgctggcgattgtt
gccgggcaattgatcccgtggcttgtcgcactgccgattatgttaatcatcatgatggta
ctactgggtcgtgaactcgcgccgctgaacaaactggcgctggcactacgtatgcgtgac
cctgactcggaaaaaccactaaacgcgacgggcgtacccagcgaagtgcgtccactagtt
gagtcgttgaatcaactgttcgcccgtacacatgcgatgatggttcgtgaacgacgcttt
acctccgacgcagctcacgaacttcgtagcccgttaacggcgctgaaagtgcaaaccgaa
gttgcgcagctctctgacgatgatccgcaggcgcggaaaaaagcgctgcttcaattacat
tccggaatcgatcgcgctactcgtctggttgatcaactgctcacgctatcgcggctggac
tcactggataaccttcaggacgtcgcggagatcccgcttgaagatctcctgcaatcgtcg
gtgatggatatttaccacacggcgcagcaggcgaaaattgacgtgcgactgacactcaat
gcccacggcatcaaacgcaccggacaaccgctgttgctaagtttgttggtacgaaacctt
ctggataacgccgtgcgttacagtccacagggcagcgtggtggacatcacgctgaatgcc
gatagtttcatcgtgagggataacggccccggtgtgacgccagaggcactggcgcgaatt
ggcgaacgcttctatcgcccacccggacaaaccgctaccggcagtggacttgggctatcg
attgtccagcgaatcgccaagctgcatggcatgaatgttgagtttgggaatgtggaacaa
ggtggatttgagacgaaggtaagctggtaa

DBGET integrated database retrieval system