KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3610Help
Entry
EC042_3610        CDS       T02067                                 

Gene name
slyD
Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:elo03110]
    EC042_3610 (slyD)
Enzymes [BR:elo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     EC042_3610 (slyD)
Chaperones and folding catalysts [BR:elo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    EC042_3610 (slyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: CBG36435
UniProt: D3GZG7
Structure
PDB: 

Position
complement(3824169..3824759)
Genome map
AA seq 196 aa AA seqDB search
MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGLETALEGHEVGDKFDV
AVGANDAYGQYDENLVQRVPKDVFMGVDELQVGMRFLAETDQGPVPVEITAVEDDHVVVD
GNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGAHDHHHDHDHDGCCGGHGHDHGHEHG
GEGCCGGKGNGGCGCH
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcaaaagacctggtggtcagcctggcctatcaggtacgtacagaagacggt
gtgttggttgatgagtctccggtgagtgcgccgctggactacctgcatggtcacggttcc
ctgatctctggcctggaaacggcgctggaaggtcacgaagttggcgacaaatttgatgtc
gctgttggcgcgaacgacgcttacggtcagtatgacgaaaacctggttcaacgcgttcct
aaagacgtatttatgggcgttgatgaactgcaggttggtatgcgtttcctggctgaaacc
gaccagggtccggtaccggttgaaatcactgcggttgaagacgatcacgtcgtggttgat
ggtaaccacatgctggccggtcagaacctgaaattcaacgttgaagttgtggcgattcgc
gaagcgactgaagaagaactggctcatggccacgttcacggtgcgcacgatcatcaccac
gatcacgaccacgatggttgctgcggtggtcatggccacgatcacggtcatgaacacggt
ggcgaaggctgctgcggcggtaaaggtaacggcggttgcggttgccactaa

DBGET integrated database retrieval system