KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3630Help
Entry
EC042_3630        CDS       T02067                                 

Gene name
cysG
Definition
(GenBank) siroheme synthase [includes: uroporphyrinogen-III C-methyltransferase; precorrin-2 dehydrogenase; sirohydrochlorin ferrochelatase]
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00860  Porphyrin and chlorophyll metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01120  Microbial metabolism in diverse environments
Module
elo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EC042_3630 (cysG)
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     EC042_3630 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     EC042_3630 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     EC042_3630 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Radical_SAM
Motif
Other DBs
NCBI-ProteinID: CBG36455
UniProt: D3GZI7
Position
3844088..3845461
Genome map
AA seq 457 aa AA seqDB search
MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAFIPQFTAWADAGMLTL
VEGPFDESLLDTCWLAIAATDDDALNQRVSEAAEARRIFCNVVDAPKAASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYAGQLRGRVKQQFATMGERRRFWE
KLFVNDRLAQSLANNDQKAITETTEQLINEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLK
GGDPFIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHL
KTGGELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGDMPVAIVENGTAVTQRVID
GTLSQLGELAQQMNSPSLIIIGRVVGLRDKLNWFSNH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatttgcctatattttgccaattacgcgatcgcgactgtctgattgtcggcggt
ggtgatgtcgcggaacgcaaagcaaggttgctgttagacgcgggtgctcgcttaacggtg
aatgcattagcgtttattccacagttcaccgcatgggcagatgcaggcatgttaaccctc
gtcgaagggccatttgatgaaagccttctcgacacctgctggctggcgattgctgcgacg
gatgatgacgcgcttaaccagcgcgtcagtgaagccgctgaagctcgtcgcatcttctgt
aacgtggtcgatgcgccgaaagccgccagctttattatgccgtcaattattgaccgctca
ccgctcatggtagcggtctcctctggcggcacctcaccggttctggcgcgcctgttgcgc
gaaaaactcgaatcactgctgccgctgcatctgggtcaggtggcgaaatatgccgggcag
ttacgtggtcgggtaaaacagcagttcgctacaatgggtgaacgtcgccgtttctgggaa
aaactgttcgttaatgaccgtctggcgcagtcgctggcaaacaacgatcagaaagccatt
accgaaacgaccgaacagttaatcaatgaaccgctcgatcatcgcggtgaagtggtgctg
gttggtgcaggtccaggcgatgcaggactactgacgctgaaaggtctgcaacaaattcag
caggcagatgtggtggtctacgaccgtctggtttctgacgatattatgaatctggtacgc
cgcgatgcggatcgcgttttcgtcggcaaacgcgcgggataccactgcgtaccgcaagaa
gagattaaccagatcctgctgcgggaagcgcaaaaaggcaaacgcgtggtgcggctgaaa
ggcggcgatccgtttatttttggtcgtggtggcgaagagctggaaacactgtgcaacgcg
ggcattccgttctcggtggttccgggtattaccgcagcttctggttgctctgcctattcg
ggtattccgctcacgcatcgcgattatgcccagagcgtacgcttaattaccggacactta
aaaaccggtggcgaactggactgggaaaacctggcggcagaaaaacagacgctggtgttc
tatatggggttgaatcaggccgcgactattcagcaaaagctgattgaacacggtatgcct
ggcgatatgccggtggcgattgtcgaaaacggaacggcagtcacgcagcgcgtgattgac
ggtacactctcgcagctgggcgaactggcgcagcaaatgaacagcccatcattaattatt
attggtcgggtcgttggcctgcgcgataaattgaactggttctccaaccattaa

DBGET integrated database retrieval system