KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4528
Entry
EC042_4528        CDS       T02067                                 

Name
(GenBank) putative type VI secretion protein
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: CBG37350
UniProt: D3GUV9
Structure
Position
4856944..4858674
AA seq 576 aa
MHVRSRLWLTILSLFLTLWLISGFLPLSAVNQIILTLVSVVAAGLVLWYQWRCLSSRRDI
PEKAGDDGLPPEYFQGHVLLVAGNSDAWFEPGQAYRETASGWYLRVDTPEQMRILAERLS
YSRPALCGQVVVMLGLLPEQHTSDEAFLSWLRNWQRAVMQCRQWLNTTPPVLVTLMVSEP
SPQNTSLNKHSTHWFTLTPDLPGMHIRLTEAGAIPAEEWLQACDAASRLRCVSELLWLNA
MLSWYNRVTDALTAICRQEHFYFRPVAVGFCLTSVAARPGNLWQQQLTSLTALPPPAGVS
SQVLPLPDILLSGIPRHRGLSHWHRLCRQTGAIVGVFLLLAMLASFMNNQRLVRSVGEHL
TAWHRMRGYSSESKTTALQRLQADSQLLNDWQQRGVPQRYGLGLYQGMWLIPPVERATGE
WVAPRPPRPVIQKVTQTPKTVRLNSLALFDAGKWTLKPGATKWLVNALVDIKAKAGWLIV
VSGHTDNTGDPLRNQALSLKRAEAVRDWMRDTGDIPQSCFAVQGYGESRPVAPNDTAEGR
ARNRRVEISLVPQADACRLPDVSPAPEEGASENITE
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgcacgtacgttcccgtctctggctgacaatactgagtctgttcctgacactgtggctg
atttcgggattcctgccgctgtctgcagtaaaccagataatactgaccctggtttcagtt
gtggcggcggggcttgtgctgtggtaccagtggcgttgtctgtcttcccgtcgtgatatc
ccggagaaggccggcgatgacggtctgccgcctgagtattttcagggacatgtgctgctt
gttgccggaaactcagatgcgtggttcgaacccggtcaggcataccgggaaacagcatcg
ggatggtatcttcgtgtggatacgccggagcagatgagaatactggcagaacggttgtcg
tacagccgtccggccctgtgtggccaggtcgtggtcatgctgggacttttaccggagcag
catacctcagatgaagctttcctgtcgtggttgcggaactggcagcgtgcagtcatgcag
tgccggcagtggctgaataccacgccaccggtgctggttacattgatggtttcagagccg
tcaccacaaaacacatccttaaataagcactctacacactggtttacactgacaccggac
ctgccgggaatgcatatacgcctgacggaagccggagcaattccggcagaggaatggctg
caggcgtgtgatgcagcgtccaggctccggtgcgtcagtgaactgttatggctgaatgcc
atgttgtcctggtacaaccgggttactgatgccctgacagctatttgccggcaggagcac
ttttatttccggccggttgccgttggattctgtctgacgtcggttgcggcccgccccggt
aatctctggcaacaacaactgacgtccctcactgcattgccaccgcctgccggcgtgtca
tcacaggtattgccgttgccggatattctgctgtccggtattccccgtcatcgtggactc
agtcactggcacagactttgtcgccagacgggggcgattgtcggtgtttttcttctgctg
gctatgctggcgtcttttatgaataaccagcggctggttcgcagcgtgggggaacacctg
acggcctggcaccggatgcgcggatattcatctgaatcgaaaacaacagcactgcaacgt
cttcaggctgacagccagttactgaacgactggcagcaacgtggtgtgccacagcgttac
ggactgggattgtatcagggaatgtggctgataccgccggttgagcgtgcgactggtgag
tgggttgcaccacggcctccccgtccggtgatacagaaagttactcagacgccgaaaacg
gttcgccttaacagcctggcactgtttgatgccggtaaatggacgctgaagccgggcgcc
acaaaatggctggtgaatgccctggtggatattaaggcaaaagcaggctggctgattgtg
gtcagtggtcacacggataataccggtgacccgctgcgcaaccaggccttgtccctgaag
cgtgcagaggccgttcgcgactggatgcgggataccggcgatattccccaaagctgtttt
gccgtacagggatacggtgaaagccgccctgtggccccgaatgacacggcggaaggccgt
gcgcgtaaccgccgtgttgaaatcagtctggtaccgcaggccgatgcctgtcgtctgccg
gacgtttcccctgcgccggaagagggcgcatcagaaaacataacggagtaa

DBGET integrated database retrieval system