KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4529
Entry
EC042_4529        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_4529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4529
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4529
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CBG37351
UniProt: D3GUW0
Structure
PDB: 
4HKH

Position
4858680..4859171
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHD
IKNPAYEKHNHLEQVELRYEKITWTYKDGNIIHSDAWSERTTA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattccagtttatctgtggctgaaagatgatggcggtgcagatatcaaagggtcc
gtggatgttcaggaccgtgagggcagcattgaggtggtggctcaggagcactgcctctac
atcccgacggataacaataccggtaagctgaccggtacccgtattcacacgccgtttctg
tttaccaaggaaattgattcttccagcccgtacctttacaaggccgtgaccaccgggcag
accctgaagtctgctgagtttaagtggtacaaaatcaatgatgccggtcaggaggtggag
tatttcaatacgaagcttgagaacgtgaaggtggtgaaggttaacccggtcatgcacgac
atcaagaatcccgcttacgagaagcataaccaccttgagcaggtggaactgcgctacgag
aaaatcacctggacttacaaggacggcaacatcattcattccgacgcatggagtgagcgt
accaccgcgtaa

DBGET integrated database retrieval system