KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4534
Entry
EC042_4534        CDS       T02067                                 
Name
(GenBank) putative type VI secretion protein
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
SSDB
Motif
Pfam: DUF2235
Other DBs
NCBI-ProteinID: CBG37356
UniProt: D3GUW5
Position
4865605..4867287
AA seq 560 aa
MTKYQGYDVTDATHKTSIHNDWKVVVAKKKPARGVTLTIGIFFDGTGNNRENTASRLMKF
NECSAARQGVNQKDAQSCEDFLKEINKNSISNGSYRGYYSNIHWLNILYHPDQVLKKDQT
SAQIKTYISGIGTAAGEADSVIGMGLGTSILDIFEGVVTKTDEAMERITQALSEFMGFNL
SPDFCIAKIQFDVFGFSRGAAAARHFANRVMEQDPAIARAIAKGLRGDFYDGKPSGEVRF
LGLFDTVAAIGGISNFFDINGRSNPGVKLELRPSVAKKVFQITAMNEYRYNFSLNSIKGM
WPELALPGAHSDIGGGYNPVGSPLQENESLFLSCPEFEIVSDDTREMDTRVYRKAEQVRK
MLMTLPALKHILPHGKLTTKIRSIGVNNSNQRRAGVIQKQVGAAVFFERMAVPNDWANVC
LRVMLDAAQEAGVLFEPIRQTNTELQLPSELIFLADKAIAQGKAVRLGQEPQAFTEEELY
IIGKYTHCSANWNIESDGNLWVDPTTGEIFIHRFGPKGNKAFVFPNKPNDRWIRSVWYMD
DQQRLNDNAVKNTKVMMSGV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgacaaaatatcagggatatgacgtaacagatgccacccataaaaccagtattcataat
gactggaaagttgttgttgcaaagaaaaaaccggcgcggggtgtgactttaactattggc
atatttttcgatggtaccggaaacaatcgggagaatacagcatctcgcctgatgaaattt
aatgagtgtagtgcagccagacagggggtaaatcaaaaagatgcacaaagctgtgaggac
tttcttaaagaaattaacaagaacagtatctcgaatggcagttatcgtggatattattcc
aatattcactggcttaatatactctatcatccagatcaggtacttaaaaaagaccagacg
tcagctcaaattaagacttacatttccgggatagggactgcggctggtgaagcagattca
gtcataggcatgggattaggcaccagtattctggatatatttgaaggtgtggtgacgaaa
accgacgaggcaatggaacgaatcacccaggcgttatcagaatttatggggttcaattta
agtcctgatttttgtatcgcaaaaatccagtttgatgtttttggttttagccggggagca
gcggcggcaaggcactttgccaatcgggttatggaacaggatcctgctatagccagagct
attgctaaagggctcagaggcgatttttatgatggtaaaccttctggtgaagtacgtttt
ctggggctttttgatactgtcgcagctattggtggaatcagtaatttcttcgatattaat
ggacgtagcaacccgggagtaaagctggagttgcgtccttcagtcgcgaagaaagttttc
cagattactgcaatgaatgaataccgatataatttcagcctgaacagtattaaaggtatg
tggcccgaactggctttaccgggggcgcattcagatattggaggtggttacaatccggta
ggttcacctctgcaggaaaatgaaagtctgtttctgagttgcccggaatttgaaattgtc
agtgacgataccagagaaatggatacgcgagtataccgtaaagcagagcaagtcagaaaa
atgttgatgactctgccagccttaaaacatattttgcctcatggaaaactaaccaccaaa
attcgttccataggtgtgaacaacagcaatcaacgtcgggctggtgtgatacaaaagcag
gtgggagccgcagtattttttgagcgtatggcagtacctaatgactgggctaatgtttgc
ctgcgtgtgatgctggatgctgctcaggaagcaggggtattgtttgaaccaattcgacaa
acaaatactgagttacaacttccatctgaactaatatttcttgctgacaaagccattgct
cagggaaaagcggtacgtttggggcaagagcctcaggcttttactgaggaagagttgtat
attatcggaaaatacacccattgttccgctaactggaatattgagtctgatggtaattta
tgggtggatcctacaacgggagagatttttatccatcgctttggtcctaaaggtaataag
gcgttcgtttttccgaataaaccaaatgatcgctggattcgttctgtatggtacatggat
gatcagcagcgattgaatgataacgcagtaaaaaatactaaagttatgatgtctggtgtt
taa

DBGET integrated database retrieval system