KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4543
Entry
EC042_4543        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion protein
  KO
K11895  type VI secretion system protein ImpH
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4543
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4543
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CBG37365
UniProt: D3GUX4
Structure
PDB: 
6N38 6GIY 6GJ3 6GJ1

Position
4877754..4878755
AA seq 333 aa
MLEQSQPDQPPIGSGWQARQEAVRFCPYPGMGFPASEIKDAVIPEESHLPPIVHVTFMGL
YGVTSPLPAHYISDIAQQREGHEAAADFLDIFSHRLITQYYRIWRKYSYPATFEAGGQDK
TSQYLLGLARLGIPGCAQNIATPVSRFLALLPLMLLPGRTAEGLTSLVTLLAPGTQARVW
HHDRRRIPLKTPLTMRVHHPVSLKSRPVMGDHATDVNGQVLLQLSTQTGSEVQGWLPGGH
LYSDLLALLHVYLGSRLDVRLQLCVERSLLPDARLSCRPAAGSPQLGRTAVMRTQAKIAT
SAARVMTISLGRYQRVQEHYQRKETQENGDYRW
NT seq 1002 nt   +upstreamnt  +downstreamnt
ttgctggaacaaagccagccagaccagcctcccattggcagtggctggcaggcccgtcag
gaagcggttcgcttttgtccatacccgggaatggggtttcctgcgagtgaaataaaagac
gctgtaattcctgaagaatcccatctgccacccattgtacatgtgacgtttatgggactt
tacggggtcacgtctccgttgccggcacactatatcagtgatattgcacagcagcgggaa
ggccatgaggccgcagcggattttctcgatatattcagtcatcgtctgatcacccagtat
taccgtatctggcgtaaatattcgtacccggccacctttgaggcgggaggacaggataaa
acatcccagtatctgctcggtctggccagactggggatccccggatgtgcacagaatatt
gccacgccggtatcgcgttttctggcgttattgcccctgatgttgttacccggaagaaca
gctgaagggctgacatcactggtaacgctgctggctcccggaacacaggcccgtgtctgg
catcatgaccgacgacggatcccgctgaaaacaccgctgaccatgcgtgttcatcacccg
gtcagtctgaagagtcgcccggtgatgggcgatcatgccacggatgtgaacggacaggtg
ttattacagctttcaacacagacgggcagcgaggtacagggctggttaccaggcgggcat
ctgtattctgatttgttggcgttgttgcatgtttatctgggaagccgtctggatgtacgt
ctgcaactttgtgttgagcgttcactgttaccggatgcccggctcagttgccgaccggca
gccggtagtccgcaactggggcgcacggcagtaatgagaacacaggcaaagatagcgact
tcagcggcacgcgtcatgaccatcagtctggggcgttatcagcgggttcaggaacattat
caacgtaaggagactcaggaaaatggcgattatcgctggtaa

DBGET integrated database retrieval system