KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4550
Entry
EC042_4550        CDS       T02067                                 

Name
(GenBank) conserved hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4550
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4550
SSDB
Motif
Pfam: VasL ImpA_N
Other DBs
NCBI-ProteinID: CBG37372
UniProt: D3GUY1
Position
4884070..4885437
AA seq 455 aa
MTSEVKLKTGGDPRSLPDYAALRDEISKLTHPARPDVDWRYVETLCLRLYEHNGVELQTA
SWYTIARMHTTGLSGLNEGLALIVALTRHHWSVMWPLNTHARLEIITGLFNHLQKTLRAM
PPDDRDNLPLLYQTETFLKALSDTLARHELKQSSKVALPEAMVKGYITRLENQPVQGEVS
SPVTLPAQALRSDAPDVQEHQTLPHSRLVYVVSETKAESGKENTHSLQKSPPTFLKPFVT
GVCAALLAVSVAIPGWQFLTQPSPAEQQLRALLTPPPDVLSAGQMTQLSRTPSLLNHASE
WITLSGQQITRLAELPPAYNLQRSAQLLQQLRVLFPDNPRVQEMVDNWQKSVRSRALPEE
AMAGWNEGMTRLQQLAERLNRLDEQRGKYMTVSELKTEVFGIMQAFNRHIPAEEQLRRYD
EVRNQNSSEQQQKKVENGLVELVSRYWVLTQGDMK
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgacttctgaagtgaaactgaaaaccggtggtgacccccggtcattaccggattatgct
gccctgcgcgatgaaatcagcaaactgactcacccggcacgcccggatgtggactggcgt
tacgtggaaacactctgcctgcgtctgtatgaacacaatggcgtggaattacagacggca
tcctggtacaccatcgcccggatgcatacaacagggttaagtggtctgaatgaagggctg
gctctgattgtggcgctgacccggcatcactggtcagtgatgtggccgctgaatacccac
gcccggctggaaattattaccggtctgttcaaccatctgcaaaaaacgcttcgggccatg
cctccggacgaccgtgacaacctgcccctgctgtatcagaccgaaacattcctgaaggca
ctgagtgacacactggcccggcacgaacttaaacagagcagtaaagtggctttaccggaa
gccatggtgaagggatatatcacccgcctggagaaccagcctgtgcagggtgaagtatcg
tctccggtaacccttccggcgcaggcactccggtctgatgctccggacgtacaggaacat
cagaccctgccgcactcccgtctggtgtatgttgtttctgaaacaaaagcagagagcgga
aaagaaaacacacattcccttcagaaatccccgcccacgtttctgaaaccgtttgtaact
ggtgtctgtgcggcattgctggcggtcagcgtggccattccgggatggcagtttctgaca
cagccatcaccggcggagcagcaactcagggcgttgctgacaccaccaccggatgtgctt
tcagcaggccagatgacacagctcagcagaacaccttcactgctaaatcatgcgtcagag
tggataaccctttccggtcagcagataacacgactggcagaactacccccggcatacaac
ctgcaacgcagtgcgcagctgctgcagcaactgagggtactttttcccgacaatccccgt
gttcaggaaatggtggataactggcagaagagtgtaaggagtcgtgcgctcccggaagag
gcgatggcgggctggaacgaaggcatgacccgcttacagcagctggctgagcgcctgaac
cgtctggatgagcagcggggaaaatacatgacggtcagtgaactgaaaacggaggtgttt
ggcatcatgcaggcttttaaccggcatatcccggcagaagagcagttacgtcgctatgat
gaagttcgtaaccagaatagcagtgaacagcagcaaaaaaaggtggaaaatggtcttgtc
gagctggtgagtcgttactgggttttgacgcaaggggacatgaagtga

DBGET integrated database retrieval system