KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4569
Entry
EC042_4569        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_4569
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4569
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4569
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 Bactofilin
Other DBs
NCBI-ProteinID: CBG37389
UniProt: D3GUZ5
Position
4898712..4900694
AA seq 660 aa
MTRQRFISDDHYKFQSEHFIRLHGCDISLFPLEIKGKESISDVYSYEIKCFSRTDHNSLD
KLHGTRLSCEIGEQYNSLPARFIHGVVTKVIYNYDNSMQHTCIIILQPEIAELASGKRTR
VWSNIKPSDIVSTILEDSLFSPPQVILYKEQNLLEYKIQYQESDLDFINRILSEAGIYYF
FVHNRDKHIMTLADDPASHPKASYDKLEHLPCENLKESRHGYIREWSFTESLKCPSVTLS
GYNESNVSEITIKSESKLTDVKPSKGVYEDIIPERKRELIKKRSEALIASCDSELKIWSG
KTDSWWLSCGECFSLDKQDYRITSLYLNAVNNDNEHAGLCYCDLCASDNKSSLNFSREFK
TPIIPGVLLARVVGPDSEEYYTDDNGRVKISFLWGEKSAAGTDKTSCWVRVSQVWSGEGF
GSQFIPRIGSEVLVSFIQGNPDYPVIVGTVYNGQNTSPFSLPENNCKSGFITRSVKNGKK
GEGHQLVFDDKEGEEKVIVTSSGDSLLTVKKDMISTINRSMSLTIAEGRNAEIKRGNDRL
VLKEGDLHNDVHGNINIKVSNGDYNLKVSGGSGSLITDKNLTLESTQSIKIKVGANEITI
STSGIDIKAAKITIEGQVSAEVKAATLKFESQAISEVKGTMLTLQGSAMTQIKGGIVNIG
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgactaggcaaagatttatatctgacgatcattataaattccagagtgaacattttatc
cggttgcacggctgtgatatatcattatttccacttgagattaaaggtaaagagtcaata
tctgatgtatatagttatgaaataaaatgctttagtaggaccgaccacaactctctggat
aagttacacggcacgcgtttgagttgtgagatcggggaacaatacaattcgttacctgcg
cgcttcattcatggtgtggtcacaaaagtgatatataattatgataacagcatgcaacat
acctgcattattatcttacaaccagagatagccgaattggcatctggtaaaagaacaaga
gtatggtcaaatataaagccatcagatattgtaagcacaattctggaagacagtttattt
agtccgccacaagtaattttatataaagaacagaatttgctggagtataagatccagtac
caggagtcagatcttgactttattaatagaattttgtctgaggcgggcatttactatttc
tttgttcataatagagataaacatattatgacattggcagatgatcctgcatctcatcct
aaagcatcttatgataaactggaacacttaccctgtgaaaatctgaaggaatcgcgtcat
ggctatatcagggaatggtctttcacagaaagtctcaaatgtccttctgtgacactttca
ggttataatgagagtaatgtcagtgaaattactataaagtcagaaagtaaactgacggat
gtaaaacccagtaagggagtttatgaagatattatcccagagagaaagcgtgagttgata
aagaaacgttctgaagcactgatagcatcatgtgacagtgaactcaaaatctggtcagga
aaaacggattcatggtggttgtcatgcggggagtgtttcagtctggacaaacaggattac
agaattacttcgttatatcttaatgctgtcaacaatgacaatgaacatgctggtttgtgt
tattgtgatttgtgtgcttcagataataaaagctcacttaatttcagccgtgaatttaaa
acacctattattcccggtgttttacttgccagagtggtcggtcctgactccgaagaatat
tatacagatgataatgggcgtgtaaaaatcagctttctctggggagaaaagtcagcggca
ggtacagataaaacctcctgttgggtccgtgtatctcaggtatggtccggggagggattc
ggtagtcagtttattcctcgcattggcagtgaggttctggttagttttatacagggtaat
cctgactatccagttatcgttggtacagtgtataatggtcagaatacatcgcctttttct
cttcctgagaataattgtaagtctggatttatcacccgtagtgttaagaatggtaaaaaa
ggagaaggtcatcaactggtttttgatgataaagaaggtgaggaaaaagttatagtgact
tcatctggtgattctctcctgactgtaaagaaggatatgatcagcactattaaccgctct
atgtcgttaactattgctgaagggcgtaatgctgaaataaaaagagggaatgacaggctt
gttcttaaagaaggtgacctacataatgatgtacatggtaatattaatataaaagtttcg
aacggagattataatcttaaagtgagcgggggaagtggtagtcttatcaccgataagaat
cttactcttgaatcaacacagtcaataaaaataaaagtgggtgcaaatgagataacgata
tccacatcaggtatagatataaaagccgctaaaattactatagaagggcaggtatcggca
gaggtcaaagcggccacacttaagtttgaaagccaggctatttctgaggtaaaaggcacc
atgttgacgcttcagggctctgcaatgacacagataaaaggtggaatcgtgaatatagga
taa

DBGET integrated database retrieval system