KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4572
Entry
EC042_4572        CDS       T02067                                 

Name
(GenBank) putative type VI secretion protein
  KO
K11902  type VI secretion system protein ImpA
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4572
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4572
SSDB
Motif
Pfam: ImpA_N T6SS_VasJ
Other DBs
NCBI-ProteinID: CBG37392
UniProt: D3GUZ8
Position
4901485..4902561
AA seq 358 aa
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRK
VRKLCEVTLRNKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEG
QEIRYSKLVRLDIDLSEYLKAYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEG
DHSVESFKRAVGKYNPRKVSEQLLQLYDLPDKIDEIESSYFFHTHEDIHHIFAKTRHIIS
EITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEKKEFYSALTPSTDKEMSREKA
IEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSMEQINRVLKG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaacaaaatagaaacggatacattactgcttcctgttataggagaatcgccggcaggt
gatgatattgagtatgatccggtgtatagcgaaatacgggaggcaagacaaaatgatccg
gactatatgtctcagggggaatgggctgtcagtgaaccccgcagagctgactggagaaaa
gtaagaaaattatgtgaggttactttacgtaataagagtaaggacctacaaattagttgc
tggtatgtggagtccttgacgcatttatatgctctggaagggatgcattgcggattggaa
tatcttgcaaagtttatttctcagtactggactacatgctggccatcgcaggaagaaggt
caggaaattcgttacagtaaattggttcgtcttgatatagatttatcagagtatctgaaa
gcatatcctcttcttgaggataaggaaatcacactttctgaatggtataaggtgttatcg
tttgaacatggagcaagtttgtcagaagctggaaaagaaagattaatagagagcgaaggt
gatcactctgttgagtccttcaaaagagctgtaggaaaatataatccccgcaaggttagt
gagcaacttctccagctttatgatctacctgacaaaattgatgagattgaatcttcttac
ttctttcatacgcatgaagatatacatcatattttcgcaaaaaccagacatatcatcagt
gagataaccgagttactgagtcgttttttgccgcaagaaacactggatcacagttcagtt
tctcaatttctaggcaaacccgatagcagagacacaaggacagcacttcctgaggagaaa
aaggaattttattctgcattaacaccctcaacagataaagagatgtcaagggagaaagct
atagagcaactggagaaaatagctatttttttcaggcaatctgaaccaaccagtcctgtt
ccttatcttctggagagggccatacgttggtcaacaatgactatgtcagaatggcttgag
gaactacttaaagataatgactctatggaacaaataaaccgtgtcttaaaaggatga

DBGET integrated database retrieval system